Gene Information

Name : ST548_p6075 (ST548_p6075)
Accession : YP_007388523.1
Strain : Enterobacter aerogenes EA1509E
Genome accession: NC_020181
Putative virulence/resistance : Virulence
Product : Putative response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2261363 - 2262079 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
ATGAGTAAAAAAATCCTGCTGGTGGAAGATGATGATGATATTGCGGCTTTGTTGCGCCTGAATCTGCAGGATGAAGGGTA
TCAAATCGTGCACGAGGCGGACGGCGCGCAGGCGCTGCGCCAGCTGGATAACGGCGTCTGGGATGCGGTGATTCTTGACC
TGATGTTGCCCAACATCGACGGGCTGGAGATTTGCCGTCGCATCCGTCAGCAAACGCGCTATCTACCGGTGATTATTATT
AGCGCCCGTTCCAGCGAAACCCAGCGCGTGCAGGGGCTGGAAATGGGGGCCGATGATTATCTGGCGAAACCTTTTTCTCT
GCTGGAGCTGATTGCCCGGGTGAAGGCGGTTTTCCGCCGTCAGGAAGCGATGGGACAAAATCTCTTGATGGATGCCGGAC
GTATCGCCTGCCACGGCCTGAATATCGACCCGCTGTCCCGGGAGGTCAGGCTGCGCGGTGAATTGGTAGACCTCACGCCG
CGCGAATTCGATCTGCTCTATTACTTTGCCCGCCATCCCGGTGAAGTTTTTTCGCGTCTGGCGCTGCTGGATAGCGTCTG
GGGCTATCAGCATGAAGGCTACGAACATACGGTCAACACGCATATTAATCGTCTGCGTACGAAAATAGAGCGCGACCCGG
CAGAGCCGGACATTATTCTTACCGTCTGGGGGAAGGGGTATAAATTTGCGCCCTATAGCGCCGGGGCGCAGTCATGA

Protein sequence :
MSKKILLVEDDDDIAALLRLNLQDEGYQIVHEADGAQALRQLDNGVWDAVILDLMLPNIDGLEICRRIRQQTRYLPVIII
SARSSETQRVQGLEMGADDYLAKPFSLLELIARVKAVFRRQEAMGQNLLMDAGRIACHGLNIDPLSREVRLRGELVDLTP
REFDLLYYFARHPGEVFSRLALLDSVWGYQHEGYEHTVNTHINRLRTKIERDPAEPDIILTVWGKGYKFAPYSAGAQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-83 79
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-83 79

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p6075 YP_007388523.1 Putative response regulator NC_012469.1.7685629. Protein 3e-43 46
ST548_p6075 YP_007388523.1 Putative response regulator AE015929.1.gene1106. Protein 2e-29 43
ST548_p6075 YP_007388523.1 Putative response regulator NC_003923.1003417.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_013450.8614146.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_002951.3238224.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_007793.3914065.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_002758.1121390.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_010079.5776364.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_002952.2859858.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_007622.3794948.p0 Protein 6e-35 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_012469.1.7686381. Protein 1e-40 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_002952.2859905.p0 Protein 5e-44 42
ST548_p6075 YP_007388523.1 Putative response regulator NC_007622.3794472.p0 Protein 4e-44 42
ST548_p6075 YP_007388523.1 Putative response regulator AE000516.2.gene3505. Protein 7e-39 42
ST548_p6075 YP_007388523.1 Putative response regulator HE999704.1.gene2815. Protein 2e-42 42
ST548_p6075 YP_007388523.1 Putative response regulator AF155139.2.orf0.gene Protein 3e-41 41
ST548_p6075 YP_007388523.1 Putative response regulator FJ349556.1.orf0.gene Protein 3e-38 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_002745.1124361.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_009782.5559369.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_002951.3237708.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator BAC0533 Protein 7e-28 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_002758.1121668.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_009641.5332272.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_013450.8614421.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator CP000647.1.gene4257. Protein 7e-28 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_007793.3914279.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator NC_003923.1003749.p0 Protein 6e-44 41
ST548_p6075 YP_007388523.1 Putative response regulator CP000034.1.gene3671. Protein 7e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p6075 YP_007388523.1 Putative response regulator VFG1563 Protein 8e-84 79
ST548_p6075 YP_007388523.1 Putative response regulator VFG1702 Protein 9e-84 79
ST548_p6075 YP_007388523.1 Putative response regulator VFG1389 Protein 1e-31 42