Gene Information

Name : ST548_p1199 (ST548_p1199)
Accession : YP_007386315.1
Strain :
Genome accession: NC_020180
Putative virulence/resistance : Resistance
Product : Mercuric resistance operon coregulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 140543 - 140905 bp
Length : 363 bp
Strand : -
Note : -

DNA sequence :
ATGAGCGCCTACACGGTATCGCAACTGGCCCATAACGCTGGGGTGAGCGTACATATCGTGCGCGACTACCTGGTGCGCGG
CTTGTTACGGCCGGTGGCCTGCACCACGGGCGGCTACGGCGTGTTCGACGATGCGGCCTTGCAACGGCTGTGCTTCGTGC
GCGCGGCCTTCGAGGCGGGTATCGGCCTGGATGCCCTGGCGCGGCTGTGCCGTGCGCTCGACGCAGCGGACGGCGCACAA
GCCGCAGCGCAGCTTGCCGTGCTGCGCCAGTTGGTCGAGCGGCGGCGCGCGGCGTTGGCCCATCTGGACGCGCAACTGGC
CTCCATGCCAGCCGAGCGGGCGCACGAGGAGGCATTGCCGTGA

Protein sequence :
MSAYTVSQLAHNAGVSVHIVRDYLVRGLLRPVACTTGGYGVFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGAQ
AAAQLAVLRQLVERRRAALAHLDAQLASMPAERAHEEALP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD AFG30119.1 MerD Not tested PAGI-2 Protein 8e-32 100
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 1e-31 100
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 8e-32 100
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 8e-32 100
merD ACN81004.1 MerD Not tested AbaR5 Protein 5e-24 83
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 6e-24 83
merD AGK07020.1 MerD Not tested SGI1 Protein 2e-25 82
merD AGK07078.1 MerD Not tested SGI1 Protein 2e-25 82
merD ABQ57370.1 MerD Not tested SGI1 Protein 4e-25 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p1199 YP_007386315.1 Mercuric resistance operon coregulator BAC0666 Protein 8e-26 83
ST548_p1199 YP_007386315.1 Mercuric resistance operon coregulator BAC0665 Protein 3e-26 82
ST548_p1199 YP_007386315.1 Mercuric resistance operon coregulator BAC0668 Protein 9e-26 82
ST548_p1199 YP_007386315.1 Mercuric resistance operon coregulator BAC0667 Protein 1e-26 81
ST548_p1199 YP_007386315.1 Mercuric resistance operon coregulator BAC0227 Protein 2e-25 81
ST548_p1199 YP_007386315.1 Mercuric resistance operon coregulator BAC0669 Protein 1e-25 76