Gene Information

Name : APECO78_02375 (APECO78_02375)
Accession : YP_007379658.1
Strain : Escherichia coli APEC O78
Genome accession: NC_020163
Putative virulence/resistance : Unknown
Product : IS911 protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 504061 - 504333 bp
Length : 273 bp
Strand : +
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA
TGCCGCGAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTAAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAG
AATGAAATATTAAAAAGGCTACCGCGCTCTTGA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEME
NEILKRLPRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-34 96
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-34 96
api80 CAF28554.1 putative transposase Not tested YAPI Protein 5e-33 92
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 6e-33 92
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-25 72
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-25 72
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-25 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-23 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-18 54
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-18 54
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 8e-18 53
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-17 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 7e-18 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-17 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-17 52
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-19 48
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 7e-19 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 8e-11 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
APECO78_02375 YP_007379658.1 IS911 protein VFG1485 Protein 8e-35 96
APECO78_02375 YP_007379658.1 IS911 protein VFG1123 Protein 5e-26 72
APECO78_02375 YP_007379658.1 IS911 protein VFG1553 Protein 8e-24 64
APECO78_02375 YP_007379658.1 IS911 protein VFG0784 Protein 3e-18 53
APECO78_02375 YP_007379658.1 IS911 protein VFG1566 Protein 3e-11 42