Gene Information

Name : prrA (MULP_04847)
Accession : YP_007370848.1
Strain : Mycobacterium liflandii 128FXT
Genome accession: NC_020133
Putative virulence/resistance : Virulence
Product : two-component response transcriptional regulatory protein PrrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5280194 - 5280904 bp
Length : 711 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGGCATGGACACTGGTGCGAACTCACCTCGGGTCTTGGTGGTCGACGACGATTCCGATGTGCTCGCCTCGCTGGA
GCGCGGTCTGCGGCTGTCCGGATTCGAAGTATCGACCGCCGTCGACGGTGCCGAGGCCTTGCGCAGCGCCACCGAGACCC
GGCCGGACGCGATCGTGCTCGACATCAACATGCCCGTGCTGGACGGCGTCAGTGTCGTTACCGCACTGCGTGCCATGGAC
AACGACGTCCCGGTCTGCGTGCTGTCCGCGCGCAGCTCGGTCGATGACCGAGTGGCCGGTCTGGAGGCCGGCGCCGATGA
CTATCTGGTCAAGCCATTCGTGCTGGCCGAATTGGTGGCCCGGGTCAAAGCGCTGCTGCGCCGCCGCGGGGCCACCGCGA
CATCTTCATCGGAAACCATCACGGTGGGCCCGCTGGAAGTAGACATCCCCGGCCGACGGGCCCGGGTCAACGGTGTCGAC
GTCGACCTCACCAAGCGCGAGTTCGACCTGCTCGCGGTCCTGGCCGAGCACAAGACGGCGGTGCTGTCGCGGGCACAACT
ACTCGAACTGGTGTGGGGCTATGACTTCGCCGCCGACACCAACGTCGTGGACGTATTCATCGGCTACCTACGCCGCAAGT
TGGAGGCCAACGGCGGCCCGCGGCTACTGCACACGGTCCGCGGGGTCGGATTCGTACTCAGGATGCAATGA

Protein sequence :
MGGMDTGANSPRVLVVDDDSDVLASLERGLRLSGFEVSTAVDGAEALRSATETRPDAIVLDINMPVLDGVSVVTALRAMD
NDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGATATSSSETITVGPLEVDIPGRRARVNGVD
VDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEANGGPRLLHTVRGVGFVLRMQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA BAC0083 Protein 2e-30 45
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA BAC0125 Protein 4e-30 44
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA BAC0197 Protein 2e-24 44
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA AE000516.2.gene3505. Protein 4e-29 44
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA BAC0638 Protein 8e-24 43
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_012469.1.7685629. Protein 5e-27 43
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA HE999704.1.gene1528. Protein 1e-30 42
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_012469.1.7686381. Protein 1e-22 42
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA HE999704.1.gene2815. Protein 1e-26 42
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA BAC0308 Protein 1e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA BAC0347 Protein 9e-24 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA BAC0111 Protein 8e-26 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_002952.2859905.p0 Protein 5e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_002951.3237708.p0 Protein 8e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_003923.1003749.p0 Protein 7e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_002758.1121668.p0 Protein 8e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_007622.3794472.p0 Protein 5e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_009641.5332272.p0 Protein 8e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_013450.8614421.p0 Protein 8e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_007793.3914279.p0 Protein 8e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_002745.1124361.p0 Protein 8e-27 41
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA NC_009782.5559369.p0 Protein 8e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA VFG1389 Protein 2e-85 98
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA VFG1390 Protein 3e-41 50
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA VFG1386 Protein 3e-36 46
prrA YP_007370848.1 two-component response transcriptional regulatory protein PrrA VFG0596 Protein 1e-25 42