Gene Information

Name : MYSTI_03651 (MYSTI_03651)
Accession : YP_007360641.1
Strain : Myxococcus stipitatus DSM 14675
Genome accession: NC_020126
Putative virulence/resistance : Unknown
Product : IS66 family transposase Orf1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4641233 - 4641622 bp
Length : 390 bp
Strand : +
Note : -

DNA sequence :
GTGCTCCTGCTGCCGCGTGCCGTCCGCATCCATCTGGCCGCTGAGCCGGTGGACATGCGCAAGTCCATCGATGGCCTCTT
CGTCCACGTGCAACGAGTCCTGGTGGCCGACACGTACTCCGGCCACCTCTTCGTCTTCGTCAGCAAGCGGCGAGACAAGG
TGAAGGTGCTGGCGTGGGACGGCGGGGGCTTCCTGCTTCTGTACAAGCGACTGGAGGCGGGCCGCTTCCGGATGCCTGAC
GTCGCGGACGACGCCACGTCGGTGCAGTTGGACTCCACCCAACTGGCCATGTTGCTCGACGGCATCGACGTCTCGCGGGT
GCGTCGGCCAGTCCGGTGGCAGCCACCCGGGCAGGCAGCCGAGGCCCAGGACACTACGGCTCGGCGGTGA

Protein sequence :
MLLLPRAVRIHLAAEPVDMRKSIDGLFVHVQRVLVADTYSGHLFVFVSKRRDKVKVLAWDGGGFLLLYKRLEAGRFRMPD
VADDATSVQLDSTQLAMLLDGIDVSRVRRPVRWQPPGQAAEAQDTTARR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-15 49
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-15 49
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-15 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-15 49
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-13 48
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-15 48
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-16 48
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-16 47
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-16 47
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-13 47
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-13 47
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-13 47
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-13 47
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-12 47
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-13 47
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-13 47
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-12 47
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-13 47
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-13 47
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-13 47
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-13 47
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-16 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MYSTI_03651 YP_007360641.1 IS66 family transposase Orf1 VFG1052 Protein 8e-14 48
MYSTI_03651 YP_007360641.1 IS66 family transposase Orf1 VFG1737 Protein 5e-16 48
MYSTI_03651 YP_007360641.1 IS66 family transposase Orf1 VFG1709 Protein 1e-13 47
MYSTI_03651 YP_007360641.1 IS66 family transposase Orf1 VFG1698 Protein 7e-14 47
MYSTI_03651 YP_007360641.1 IS66 family transposase Orf1 VFG0792 Protein 1e-13 47
MYSTI_03651 YP_007360641.1 IS66 family transposase Orf1 VFG1665 Protein 1e-16 46