Gene Information

Name : D781_2146 (D781_2146)
Accession : YP_007344603.1
Strain : Serratia marcescens FGI94
Genome accession: NC_020064
Putative virulence/resistance : Resistance
Product : cation/cationic drug transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2262187 - 2262519 bp
Length : 333 bp
Strand : +
Note : PFAM: Small Multidrug Resistance protein

DNA sequence :
ATGACGGGACTGATGTATTTAACCATGGCGATTATCGCCGAGGTGATCGCCACCACCATGCTGAAGGCGTCGGAAGGGTT
CACCCGGCTGTGGCCCTCGCTGGTGGTGGTGCTGGGCTATGGCGTGGCTTTTTGGGGGCTGTCGATGGTGGTGAAAAGCA
TGCCGCTTGGCATTGTGTACGCGATTTGGTCCGGCATGGGCGTCGTTCTGGTGTCGATCGCCGCGGTGTTTATTTATAAC
CAGAAGCTCGACTGGCCGGCAATTATCGGCATGGGATTAATCGTCGCCGGCGTATTGGTGATTAATCTGTTGTCCAAAAC
CAGCGCCCACTAA

Protein sequence :
MTGLMYLTMAIIAEVIATTMLKASEGFTRLWPSLVVVLGYGVAFWGLSMVVKSMPLGIVYAIWSGMGVVLVSIAAVFIYN
QKLDWPAIIGMGLIVAGVLVINLLSKTSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-17 54
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-17 54
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-17 54
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-17 54
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-17 54
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-17 54
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-17 54
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-17 54
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-17 54
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-17 54
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-17 54
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 54
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-17 54
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 54
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-17 54
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 54
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-17 54
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-17 54
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-17 54
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-17 54
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 8e-13 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0377 Protein 2e-42 89
D781_2146 YP_007344603.1 cation/cationic drug transporter CP004022.1.gene1549. Protein 1e-35 72
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0324 Protein 5e-21 60
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0322 Protein 2e-22 59
D781_2146 YP_007344603.1 cation/cationic drug transporter NC_002695.1.913273.p Protein 1e-22 55
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0150 Protein 1e-22 55
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0323 Protein 6e-18 54
D781_2146 YP_007344603.1 cation/cationic drug transporter CP001138.1.gene1489. Protein 8e-22 53
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0002 Protein 2e-20 52
D781_2146 YP_007344603.1 cation/cationic drug transporter NC_010410.6003348.p0 Protein 2e-20 52
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0325 Protein 1e-17 44
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0327 Protein 5e-17 44
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0140 Protein 6e-17 42
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0329 Protein 8e-16 42
D781_2146 YP_007344603.1 cation/cationic drug transporter BAC0192 Protein 1e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
D781_2146 YP_007344603.1 cation/cationic drug transporter VFG1587 Protein 3e-13 42