Gene Information

Name : Thethe_01764 (Thethe_01764)
Accession : YP_007299078.1
Strain : Thermoanaerobacterium thermosaccharolyticum M0795
Genome accession: NC_019970
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1733573 - 1734280 bp
Length : 708 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB

DNA sequence :
TTGACACATACAATTCTTGTAATCGAAGATGAAGCACATATTCTAGAACTTTTAAGGTATAATCTTGAGGCACAAGGATA
TAATGTCATACTTACTGATAGCGGCAAAGAAGGACTTGAAAAATGCAGAGAATTAAGTCCTGATCTAGTTCTTTTAGATT
TAATGCTTCCTGATATAGATGGCATCGATGTCTGTAAAAAGATAAAATCTGATGAACACCTTAAAAACATTCCGATTATA
ATGTTAACCGCAAAAAGTGAAGAATTTGATAAAATACTGGGTTTAGAGCTGGGAGCAGATGATTACATTACAAAACCATT
TAGCATAAGAGAATTGCTGGCTAGGATAAAAGTTGTTTTAAGAAGATCAAAAAATGAAACCGAAGATAATGAGATAATTA
AATTTGGAGACATTACTATAGATACCGAAAAGCACATAGTGTATAAAGGCAATGAAATTCTTGACCTTACTTTGAAGGAG
TTTGAACTGCTTAAACTTTTATCGAAAAACAGAGGTAAAGTTCTCACGCGTGATTATTTATTGGACAAGGTTTGGGGATA
TGAATACGCCGGTGAGACAAGAACGGTGGATGTCCATATAAGACATTTGAGAAAGAAGATTGAAGATGATGATAAGTTGC
CTGTGTACATTGAAACTGTTAGAGGTATCGGCTACAAATTAAAAGACATAGGTGAAGGCAATGCTTAA

Protein sequence :
MTHTILVIEDEAHILELLRYNLEAQGYNVILTDSGKEGLEKCRELSPDLVLLDLMLPDIDGIDVCKKIKSDEHLKNIPII
MLTAKSEEFDKILGLELGADDYITKPFSIRELLARIKVVLRRSKNETEDNEIIKFGDITIDTEKHIVYKGNEILDLTLKE
FELLKLLSKNRGKVLTRDYLLDKVWGYEYAGETRTVDVHIRHLRKKIEDDDKLPVYIETVRGIGYKLKDIGEGNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 2e-24 42
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 1e-28 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 1e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 1e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 2e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 2e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 2e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 2e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 2e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 2e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 2e-46 55
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-41 53
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 9e-45 50
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 6e-36 47
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 2e-38 46
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 2e-27 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-31 45
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 7e-24 44
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0039 Protein 9e-24 44
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000034.1.gene2186. Protein 9e-24 44
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002695.1.916589.p Protein 9e-24 44
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP001138.1.gene2239. Protein 5e-23 44
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0596 Protein 5e-23 44
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP001918.1.gene3444. Protein 2e-23 43
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 3e-26 42
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 9e-25 42
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP004022.1.gene1676. Protein 1e-22 42
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000647.1.gene2531. Protein 1e-24 42
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-27 41
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thethe_01764 YP_007299078.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 1e-30 41