Gene Information

Name : Thethe_01629 (Thethe_01629)
Accession : YP_007298962.1
Strain : Thermoanaerobacterium thermosaccharolyticum M0795
Genome accession: NC_019970
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1586928 - 1587614 bp
Length : 687 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGGAGAAAACATACTTATAATTGAAGATGAGAAAAAAATTGCGAGATTTTTGCAAATAGAGCTTGAACATGAAGGTTA
TAATGTTGCAATAGAATACAGCGGCAATGAGGGCTTAAGAAGAGCTTTAGATGGGAATTACGATTTGATTATTTTAGATT
TGATGCTCCCTGGTATGGATGGCTTCTCAGTTTTAAAGGAAATACGAAAGAAATCATCGATTCCTGTCATAATTTTAAGC
GCTAAAGATGAAATAAAAGACAAGGTAATGGGGCTTGACATAGGTGCGGATGACTATCTGACGAAGCCGTTCTCGATTGA
AGAGCTGATGGCAAGGATCAGAAATGCTCTTAGAAAAAATATCAAAGCAAATACTAAAAAAATAAGCTATGATGGAATAA
CGATGGATTTGTCTACATATGAAGTTTTAAGAGATGGACAAAAAATAGAACTTACCAAAAAAGAGTTTGATCTTCTTAAA
TATCTTATTATAAATGCTGAAATAGTATTAACGCGTGAAAATATATTAGAAAATGTATGGGGATACAATTATATTGGTGA
GACAAACATCGTAGATGTATACATAAGATATTTGCGAAGTAAAATAGACGAGCCGTTTAGCAATAAGTTAATACAAACAA
TCAGAGGTGTGGGATACTCTCTAAGGAAAGAAAAAAATGAGAATTAG

Protein sequence :
MGENILIIEDEKKIARFLQIELEHEGYNVAIEYSGNEGLRRALDGNYDLIILDLMLPGMDGFSVLKEIRKKSSIPVIILS
AKDEIKDKVMGLDIGADDYLTKPFSIEELMARIRNALRKNIKANTKKISYDGITMDLSTYEVLRDGQKIELTKKEFDLLK
YLIINAEIVLTRENILENVWGYNYIGETNIVDVYIRYLRSKIDEPFSNKLIQTIRGVGYSLRKEKNEN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-50 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-49 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 2e-53 55
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 6e-48 53
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 3e-44 47
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 3e-51 47
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 3e-45 46
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 8e-34 45
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 2e-35 44
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 5e-44 44
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 1e-41 44
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 5e-41 43
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 9e-42 43
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 5e-39 42
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 2e-43 42
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 8e-42 42
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AM180355.1.gene1830. Protein 9e-35 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1202. Protein 3e-34 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 9e-45 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-44 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 3e-36 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 8e-33 41
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000675.2.gene1535. Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 1e-50 47
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 2e-48 42
Thethe_01629 YP_007298962.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 8e-44 41