Gene Information

Name : Halru_0479 (Halru_0479)
Accession : YP_007283247.1
Strain : Halovivax ruber XH-70
Genome accession: NC_019964
Putative virulence/resistance : Resistance
Product : cation/cationic drug transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 512091 - 512483 bp
Length : 393 bp
Strand : -
Note : PFAM: Small Multidrug Resistance protein

DNA sequence :
GTGGCGCAAGTGGTGGCGGATTTCACCGCGTACATATCGGGACCGGTGAAAGGGATCGACATGAATCCGTACGCACTGCT
CACCGCGGCGATCCTCTCCGAACTCGTCGGAACGACCGCGCTCAAGCTCTCGGAGGGGTTCTCGCGGCCCGTTCCGAGCG
TCGGCGTCGTCGTCGGATACGGGCTGGCGTTTTACCTGCTGTCGCTGACGCTGGATGAATTGCCGATCGGCGTCGTCTAC
GCGACGTGGGCGGCGCTCGGGATCGTCGGGGTGGCGGCGATCGGGTTCGTCGCGTTCGACGACTCGATAGATGCGGCCGG
GATCGTCGGCTTGCTCCTCATCATCGCTGGCGTCTACTGCGTCAACGTGCTCTCCGAGATGTCGACGCACTGA

Protein sequence :
MAQVVADFTAYISGPVKGIDMNPYALLTAAILSELVGTTALKLSEGFSRPVPSVGVVVGYGLAFYLLSLTLDELPIGVVY
ATWAALGIVGVAAIGFVAFDDSIDAAGIVGLLLIIAGVYCVNVLSEMSTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-09 48
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-09 48
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-09 48
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-09 48
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-09 48
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-09 48
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-09 48
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-09 48
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-09 48
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-09 48
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-09 48
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-09 48
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-09 48
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-09 48
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-09 48
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-09 48
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-09 48
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-09 48
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-09 48
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-09 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0324 Protein 8e-12 50
Halru_0479 YP_007283247.1 cation/cationic drug transporter NC_010410.6003348.p0 Protein 6e-10 49
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0002 Protein 6e-10 49
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0139 Protein 8e-11 49
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0323 Protein 6e-10 48
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0322 Protein 3e-12 47
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0377 Protein 1e-10 47
Halru_0479 YP_007283247.1 cation/cationic drug transporter CP004022.1.gene1549. Protein 2e-08 46
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0150 Protein 2e-10 45
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0140 Protein 7e-05 45
Halru_0479 YP_007283247.1 cation/cationic drug transporter NC_002695.1.913273.p Protein 2e-10 44
Halru_0479 YP_007283247.1 cation/cationic drug transporter BAC0321 Protein 2e-09 42