Gene Information

Name : BN45_20008 (BN45_20008)
Accession : YP_007267419.1
Strain : Mycobacterium canettii CIPT 140070017
Genome accession: NC_019952
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 877298 - 877609 bp
Length : 312 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGCCGAGCAAGTACGACGAGAACACCAAGGCCAGGGCCGTGCGGCTGGTCCGGGAACACCGCGATGATTACGACTCGGA
GTGGGCGGCGATGAAGGCGATCGCCGGCCGGCTGGGGATGACCGCGGAGACGCTGCGCAAGTGGGTGCGCCAAGCAGAGA
TCGACGCCGGTGAGGCGGCGGGCGTCTCCACCGAGGAGAGTCGAGAGCTGCGGGAGCTACGGAAGAAGAACCGGGAGCTT
GAGCAAACTATCGAAATCCTCAAGGCTGCAACGACTTTCTTCGCGCGGGAGTGCGACCCGCTACACCGCTGA

Protein sequence :
MPSKYDENTKARAVRLVREHRDDYDSEWAAMKAIAGRLGMTAETLRKWVRQAEIDAGEAAGVSTEESRELRELRKKNREL
EQTIEILKAATTFFARECDPLHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 1e-10 45
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 1e-10 45
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 1e-10 45
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 5e-11 45
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 1e-10 45
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 5e-11 45
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 7e-11 45
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 5e-11 45
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 5e-11 45
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 6e-09 44
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 6e-09 44
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 6e-09 44
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-07 43
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-07 43
unnamed AAF09023.1 unknown Not tested SHI-O Protein 2e-07 43
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-07 43
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 2e-07 43
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 2e-07 43
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 2e-07 43
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-06 43
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 4e-06 43
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-06 43
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 4e-06 43
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 6e-06 43
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-07 43
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 2e-07 42
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 4e-06 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN45_20008 YP_007267419.1 hypothetical protein VFG0643 Protein 7e-08 43
BN45_20008 YP_007267419.1 hypothetical protein VFG1717 Protein 2e-06 43
BN45_20008 YP_007267419.1 hypothetical protein VFG0606 Protein 5e-08 42