|
Name : mmr (BN45_60053) Accession : YP_007269762.1 Strain : Mycobacterium canettii CIPT 140070017 Genome accession: NC_019952 Putative virulence/resistance : Resistance Product : Multidrugs-transport integral membrane protein Mmr Function : - COG functional category : - COG ID : - EC number : - Position : 3529272 - 3529595 bp Length : 324 bp Strand : + Note : Evidence 1c : Function experimentally demonstrated in the studied genus; PubMedId : 12657046, 9811672; Product type t : transporter DNA sequence : TTGATCTACCTATACCTCTTGTGCGCGATCTTCGCGGAAGTGGTGGCAACCAGCCTGCTCAAAAACACGGAAGGGTTCAC TCGGTTGTGGCCCACGGTGGGCTGTCTAGTGGGTTATGGCATCGCTTTCGCGCTGCTGGCCTTGTCGATCTCGCACGGCA TGCAGACGGACGTCGCCTATGCGCTGTGGTCGGCAATCGGTACGGCCGCCATTGTGCTGGTCGCCGTACTGTTTCTCGGC TCGCCGATATCTGTGATGAAGGTGGTTGGCGTCGGCCTGATTGTCGTCGGCGTGGTCACGTTGAACCTGGCGGGTGCCCA TTGA Protein sequence : MIYLYLLCAIFAEVVATSLLKNTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAAIVLVAVLFLG SPISVMKVVGVGLIVVGVVTLNLAGAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-08 | 44 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 1e-08 | 44 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 1e-08 | 44 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 2e-08 | 44 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 1e-08 | 44 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-08 | 44 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-08 | 44 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-08 | 44 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-08 | 44 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-08 | 44 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 2e-08 | 44 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 1e-08 | 44 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-08 | 44 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 2e-08 | 44 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 1e-08 | 44 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 1e-08 | 44 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-08 | 44 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-08 | 44 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-08 | 44 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| mmr | YP_007269762.1 | Multidrugs-transport integral membrane protein Mmr | AE000516.2.gene3301. | Protein | 2e-34 | 99 |
| mmr | YP_007269762.1 | Multidrugs-transport integral membrane protein Mmr | BAC0249 | Protein | 2e-34 | 99 |
| mmr | YP_007269762.1 | Multidrugs-transport integral membrane protein Mmr | NC_002695.1.913273.p | Protein | 3e-11 | 46 |
| mmr | YP_007269762.1 | Multidrugs-transport integral membrane protein Mmr | BAC0150 | Protein | 3e-11 | 46 |
| mmr | YP_007269762.1 | Multidrugs-transport integral membrane protein Mmr | BAC0322 | Protein | 5e-09 | 44 |
| mmr | YP_007269762.1 | Multidrugs-transport integral membrane protein Mmr | BAC0323 | Protein | 6e-09 | 44 |
| mmr | YP_007269762.1 | Multidrugs-transport integral membrane protein Mmr | BAC0329 | Protein | 4e-11 | 41 |
