Gene Information

Name : Thimo_3772 (Thimo_3772)
Accession : YP_007246054.1
Strain :
Genome accession: NC_019941
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 67017 - 67379 bp
Length : 363 bp
Strand : -
Note : PFAM: IS66 Orf2 like protein

DNA sequence :
ATGTTCTTCCCCGAGGGTCGGGTGCGGGTCTTTCTCCACGGCCGCCCGGTCGACATGCGCAAGTCCTTCACCGGTCTGAT
TGCCTTGACGCAGCAGGCGCTCGCCCAGGATCCCCTTTCGGGGCATCTGTTCGTCTTCGTCAATCGCCGCGGTGATTATC
TGAAGGTCCTCTACTGGGACCGCAGCGGCTTCTGTCTGTGGTGCAAGCGCCTGGAGCGCGGGCGCTTCATCAGTGATTGG
CGCAAGCGCCAGGATCAGGAGCTCGACGTCACCGGTTTGCGGCTGCTGTTGGAGGGCATCGAGCCGGCGCGACGGCGTCT
GCGCTATGCACGAGAAGGTGAAAAGAGAACCGCAATCTGGTAG

Protein sequence :
MFFPEGRVRVFLHGRPVDMRKSFTGLIALTQQALAQDPLSGHLFVFVNRRGDYLKVLYWDRSGFCLWCKRLERGRFISDW
RKRQDQELDVTGLRLLLEGIEPARRRLRYAREGEKRTAIW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-14 48
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-14 48
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-14 47
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-12 45
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-15 45
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-12 44
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-12 44
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-12 44
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-12 44
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-12 44
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-12 44
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-12 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-12 44
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-13 44
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-13 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-13 44
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-12 44
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-12 44
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-12 43
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-12 43
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-12 43
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-12 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-12 43
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-12 43
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 4e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thimo_3772 YP_007246054.1 transposase VFG1665 Protein 2e-14 47
Thimo_3772 YP_007246054.1 transposase VFG1052 Protein 4e-13 45
Thimo_3772 YP_007246054.1 transposase VFG0792 Protein 5e-13 44
Thimo_3772 YP_007246054.1 transposase VFG1709 Protein 5e-13 44
Thimo_3772 YP_007246054.1 transposase VFG1737 Protein 2e-13 44
Thimo_3772 YP_007246054.1 transposase VFG1698 Protein 4e-13 43