Gene Information

Name : Thimo_3693 (Thimo_3693)
Accession : YP_007245979.1
Strain : Thioflavicoccus mobilis 8321
Genome accession: NC_019940
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4037473 - 4038045 bp
Length : 573 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCCGTTTCACTCACCAAGGGTGGCAATGTCTCCCTGACCAAGGAGGCCCCCGGCCTCACCAAGCTCCACTTCGGTCT
CGGCTGGGACGCACGCAGCACCGACGGGGCGGCGTTCGACCTGGATGCCTCGGCCCTGGTCGTCGGCGAGGACGGCAAGG
CGCTGAGCCCCAAGCATTTCGTCTTCTTCAACAACCTCAAGGACCCCGAGGGAGCCGTCGCGCACCAGGGTGACAACCTG
ACCGGTGCCGGCGAGGGCGATGACGAGGTGATCAAGGTCGACCTCTCGGCACTGCCCGCTGCGGCCAAGAAGGTCGTCTT
CGTCGTCACCATCTACGATGCCGAGAGCCGTAAGCAGAACTTCGGCCAAGTCAGCAACGCCTTCATCCGCGGCGTCAACG
ACGCCGACCAGAAGGAAATCGTCCGCTACGATCTCTCCGAGGACTTTTCGACCGAGACGGCGATGCTCTTCGGCGAGCTC
TATCGCCATGGCGAGGAGTGGAAGTTCAAGGCCATCGGCCAGGGCTATGCCGGCGGCCTGCCGGCCGTCGCCCGCGACTT
CGGCGTCCAATAG

Protein sequence :
MAVSLTKGGNVSLTKEAPGLTKLHFGLGWDARSTDGAAFDLDASALVVGEDGKALSPKHFVFFNNLKDPEGAVAHQGDNL
TGAGEGDDEVIKVDLSALPAAAKKVVFVVTIYDAESRKQNFGQVSNAFIRGVNDADQKEIVRYDLSEDFSTETAMLFGEL
YRHGEEWKFKAIGQGYAGGLPAVARDFGVQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-57 68
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-57 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-57 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-54 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 61
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-57 60
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-30 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thimo_3693 YP_007245979.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 2e-58 67
Thimo_3693 YP_007245979.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 5e-57 60