Gene Information

Name : Thimo_3692 (Thimo_3692)
Accession : YP_007245978.1
Strain : Thioflavicoccus mobilis 8321
Genome accession: NC_019940
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4036798 - 4037373 bp
Length : 576 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGGAGTTACTCTCGAAAAGGGTGGTCGCGTCTCTCTCGACAAGGCCGCACCGGGTCTGCGAGTCGTTCACGTCGGTCT
CGGCTGGGATCCGCGCGTCACCGACGGCTCGGATTTCGATCTGGACGCCTCGGCGTTTCTCCTGGGAGAGAGCGGCAAGG
TCTCGTCCGATCAGGACTTCGTCTTCTATAACAACCTCGAATCGCCCGACGGCTCGGTACGCCATACCGGCGACAACCTG
ACCGGCGCCGGCGAGGGCGACGATGAGGTGATCATGGTAGATCTCCCCGCGGTCCCCGCCAGCGTGCAGAAGATCGCCTT
CACGGTGACGATCCACGACGCGCAGGCGCGGCGACAGAACTTTGGTCAGGTCGCCAATGCCTTCATTCGGCTCGTCGATG
CCGACAAGGGCACCGAGGTGGTGCGCTTCGACCTCGGCGAGGACTACTCGACCGAGACGGCGATGGTCTTCGCCGAGCTC
TACCGCCATGGCGGCGAGTGGCGCTTCAACGCGGTCGGCCAAGGCTATGCCGGCGGCCTGAAGGCCATGTGCGAGCAGTA
CGGGGTACGCATCTAG

Protein sequence :
MGVTLEKGGRVSLDKAAPGLRVVHVGLGWDPRVTDGSDFDLDASAFLLGESGKVSSDQDFVFYNNLESPDGSVRHTGDNL
TGAGEGDDEVIMVDLPAVPASVQKIAFTVTIHDAQARRQNFGQVANAFIRLVDADKGTEVVRFDLGEDYSTETAMVFAEL
YRHGGEWRFNAVGQGYAGGLKAMCEQYGVRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 70
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-64 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-63 69
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-56 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-56 63
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-56 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-56 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-30 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thimo_3692 YP_007245978.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 1e-62 68
Thimo_3692 YP_007245978.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 4e-60 64
Thimo_3692 YP_007245978.1 stress response protein, TerZ- and CABP1 BAC0392 Protein 4e-26 42