Gene Information

Name : B479_00465 (B479_00465)
Accession : YP_007226954.1
Strain : Pseudomonas putida PC9
Genome accession: NC_019905
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 101369 - 102043 bp
Length : 675 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGCGTTCTAGTTGTGGAAGACGAAATTAAAACTGCCGAATATCTTCAGCAGGGCCTATCCGAAAGCGGGTATGTCGT
AGATATCGTGCACAACGGTGTAGATGCTCTGCACTTGTTCAACACTAATGTCTATTCGTTGGTCCTCCTGGACGTGAACC
TCCCGGGTATCGACGGCTGGGACCTGCTGGAAACCATCCGTAAGACCAGCCGGGTCCGCATCATCATGCTGACCGCCCGC
GGACGCATCAATGACAAGCTCAAGGGCTTGGACGGCGGCGCGGATGACTACCTTGTGAAGCCATTCGAATTCCCTGAGCT
GCTTGCTCGCATCCGTTCGCTGCAACGCCGTGGTGATGAGTTAGTCGAGAAGAGCTCGCTGAAAATTGCCGATCTGGAAC
TCGACTCCGTCCGCCATCGCGTCTTCCGCGGTGGCACACGCATCGATCTCACCACCAAGGAATTTGCGCTTCTGCACCTG
CTCATGAGCCGAACGGGCGAAGCGCTGACTCGCTCTCAGATCATCTCGTTGGTCTGGGATATGAATTTCGATTGCGACAC
CAATGTCATCGATGTAGCCATCCGGCGCTTGCGCTCGAAGATCGATGAGCCGTTTGAAACCAAGCTCATTCACACGCTTC
GTGGCGTTGGGTACGTTTTTGAGGAACGCGCATGA

Protein sequence :
MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNVYSLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTAR
GRINDKLKGLDGGADDYLVKPFEFPELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHL
LMSRTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDEPFETKLIHTLRGVGYVFEERA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-48 52
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-48 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-57 60
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-55 57
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator BAC0638 Protein 8e-50 57
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator BAC0083 Protein 3e-54 56
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-51 55
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-54 55
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator BAC0347 Protein 6e-50 52
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 3e-30 41
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator VFG0596 Protein 4e-49 51
B479_00465 YP_007226954.1 two component heavy metal response transcriptional regulator VFG1390 Protein 2e-34 43