Gene Information

Name : B479_21105 (B479_21105)
Accession : YP_007231054.1
Strain : Pseudomonas putida PC9
Genome accession: NC_019905
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4649122 - 4649796 bp
Length : 675 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGTCTACTGATCATCGAGGACGAACTGCGCACCGCCGACTACCTGCAGCAGGGCCTGCGCGAGAACGGCTACGTGGT
CGACTGCGCCCACACCGGCACCGATGGCCTGCACCTGGCCCGCCAGCAGCCCTACGACCTGGTCATTCTCGACGTCAACC
TGCCCGAGCTCGATGGCTGGACCGTGCTGCAGCGGCTGCGCGCCGAATCGGCCACGCGCATCATGATGCTGACCGCCCAT
GGCCGCCTGGCCGACCGAGTCAAGGGCCTGGACCTGGGTGCCGACGATTACCTGCTCAAACCTTTCGAGTTCCCGGAACT
GCTGGCCCGTATCCGCAGCCTGCTGCGCCGCAACGACCAGCAACTGCAGCCCAGCACCCTGCGCGTCGCCGATCTGGAGC
TGGACCCCGGCCGCCACCGCGCCTACCGCGCCGGGCAGCGTATCGACCTGACCGCCAAGGAATTCGCCCTGCTGCACCTG
CTGATGCGTCAGACCGGCGAGGTGCTGTCGCGCACCCAGATCATCTCGCTGGTGTGGGACATGAATTTCGACTGCGACAC
CAATGTGGTCGAGGTTTCGATCCGGCGCCTGCGGGCCAAGATCGACGACCCGTTCGACAACAAGCTGATCCATACCCTGC
GTGGCGTCGGCTACGTGCTCGAGGCACGCTTTTGA

Protein sequence :
MRLLIIEDELRTADYLQQGLRENGYVVDCAHTGTDGLHLARQQPYDLVILDVNLPELDGWTVLQRLRAESATRIMMLTAH
GRLADRVKGLDLGADDYLLKPFEFPELLARIRSLLRRNDQQLQPSTLRVADLELDPGRHRAYRAGQRIDLTAKEFALLHL
LMRQTGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDNKLIHTLRGVGYVLEARF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-56 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator BAC0083 Protein 7e-62 60
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator BAC0125 Protein 8e-66 60
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-64 59
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-55 59
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-57 56
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-61 55
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-57 51
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-32 42
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 2e-33 42
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 6e-29 42
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-56 53
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-36 44
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-38 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-38 43
B479_21105 YP_007231054.1 two component heavy metal response transcriptional regulator VFG0473 Protein 1e-30 41