Gene Information

Name : phoP [H] (TVNIR_0556)
Accession : YP_007215739.1
Strain : Thioalkalivibrio nitratireducens DSM 14787
Genome accession: NC_019902
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 526776 - 527480 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence : 
GTGAATCTGCGTGTGGTGCTGATCGAGGACGACGATTCGCTGCGGGAGCGCCTGGCCGATGCCTTGAGTGCGGCCGGCTG
GCGCGTGGATCGGACTGCAGACGGAAAGGACGGGCTATACCAGCTGACCGAGTACCCCTGCGACATCGCGATCGTCGATC
TCGGCCTGCCGGGGCTCGACGGCCTCGAAGTGATCCGCCGGGCCCGGGCGGTCAATGCCCGTCTTCCGATCCTGGTTCTG
ACCGCCCGGGATCGCTGGCAGGACAAGGTGGAAGGCCTCGAGGCGGGGGCGGACGACTACCTGACCAAGCCGTTTCACGT
CGAGGAGTTGCAGGCACGGTTGCGCGCCCTGGTGCGGCGTAGCCTGCAGGATGGCCAGGAACGCCTGGACTTCGGTCCGC
TGGTCATCGACACAGCGACCGATACCGTGCTGGTGCACGGTGAGGCGGTGACCCTGACCACTTTCGAGTATCGGCTGCTC
TTGCAGCTGGTGCGGCAGGCCGGGCGCCCGCTGAGCAAGGATATGCTCGCCGACTACCTCTACGAACACGATGACGACCG
CGAGAGCAACGTGATCGAGGTGCTGATCGGTCGCTTGCGGCGCAAGCTCGATCCGGACGGGCGCCTGGGCGTGATCGAGA
CACTGCGCGGGCGCGGCTACCGATTCACACTGCAGCCGGCCGAGGCGCGCAGTTCCGGCACATGA

Protein sequence : 
MNLRVVLIEDDDSLRERLADALSAAGWRVDRTADGKDGLYQLTEYPCDIAIVDLGLPGLDGLEVIRRARAVNARLPILVL
TARDRWQDKVEGLEAGADDYLTKPFHVEELQARLRALVRRSLQDGQERLDFGPLVIDTATDTVLVHGEAVTLTTFEYRLL
LQLVRQAGRPLSKDMLADYLYEHDDDRESNVIEVLIGRLRRKLDPDGRLGVIETLRGRGYRFTLQPAEARSSGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 9e-51 49
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family CP000034.1.gene2022. Protein 3e-45 48
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family NC_002695.1.913289.p Protein 4e-44 47
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family CP001918.1.gene2526. Protein 2e-44 47
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family CP000647.1.gene1136. Protein 5e-44 47
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family CP001138.1.gene1939. Protein 4e-45 47
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family BAC0530 Protein 4e-44 46
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family CP004022.1.gene1005. Protein 2e-44 45
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-27 42
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family BAC0487 Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family VFG0475 Protein 4e-45 47
phoP [H] YP_007215739.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-28 41