Gene Information

Name : A7A1_1908 (A7A1_1908)
Accession : YP_007210966.1
Strain : Bacillus subtilis BSP1
Genome accession: NC_019896
Putative virulence/resistance : Resistance
Product : General stress protein 16U
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3728979 - 3729425 bp
Length : 447 bp
Strand : -
Note : -

DNA sequence :
GTGTTTCTGTTAGACGCCGCAGGCAAATGCGCGTCACCAAACGACTTTATTTTCTACAACCAGCTTGAAGGCGGCAACGG
TTCAGTCGTTCATTCAGGCGACAACCTGACTGGTGCTGGCGAAGGCGACGATGAGAATGTAAAAGTAAATCTCAGCGCTG
TACCGGCAAACATTGATAAAATCTCATTTGTTATTACCATTCACGATGCAGAAGCGCGCAGCCAAAACTTTGGACAAGTA
TCAAACGCGTTTGTCCGCATCGTAAATGAAGAAACAAATGAAGAGCTCATCCGTTACGATCTTGCAGAAGATTTCTCTAT
TGAAACGGCAATCATTGCAGGGGAGCTTTACAGACATAACGGCGAGTGGAAATTCTCAGCAATCGGCTCAGGCTACCAAG
GCGGCCTTGCCCGCATTGCAACAGACTACGGTTTGCAAGTCGGTTAA

Protein sequence :
MFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQNFGQV
SNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYRHNGEWKFSAIGSGYQGGLARIATDYGLQVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-44 64
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-43 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-43 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-43 60
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-34 52
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-34 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-34 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-33 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A7A1_1908 YP_007210966.1 General stress protein 16U BAC0389 Protein 6e-43 60
A7A1_1908 YP_007210966.1 General stress protein 16U BAC0390 Protein 2e-38 52