Gene Information

Name : C770_GR4pC1257 (C770_GR4pC1257)
Accession : YP_007193540.1
Strain :
Genome accession: NC_019848
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1234491 - 1234895 bp
Length : 405 bp
Strand : -
Note : -

DNA sequence :
ATGGTACAGAGTCAAGGCCTTCAAGAACTGACGATCGGAAAACTTGCGGCTGCCGGAGGCGTGGGTGTTGAAACCATCCG
TTTCTACCAGCGCAAGGGCCTGCTGGCGACGCCGAAGCGGTTAGAAGGCGTGCGCCGCTATGGAGGCGAAGACGTGCGCC
GACTACGTTTCATAAAACAGGCGCAGGCGGCCGGTTTCACGCTTGAGGAGATCGGGCAGCTTCTGGCACTGGATGCCGGG
CACAACCGCTCGGCTGCACGGGACCTGGCGAAGAAGAAGCTTGAGCAGCTGGATGCCAGGATTGGAGAGCTTAATCGCGC
GCGGGAAGCACTCCGTAAGCTGGTCTCTGAATGCGCAGAGGACAAGACCGGGCCGTGTCCGATCCTGGCTTCCTTTGGAG
TTTGA

Protein sequence :
MVQSQGLQELTIGKLAAAGGVGVETIRFYQRKGLLATPKRLEGVRRYGGEDVRRLRFIKQAQAAGFTLEEIGQLLALDAG
HNRSAARDLAKKKLEQLDARIGELNRAREALRKLVSECAEDKTGPCPILASFGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-25 49
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-26 48
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-25 48
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-25 47
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-25 47
merR AGK07025.1 MerR Not tested SGI1 Protein 5e-25 47
merR AGK07083.1 MerR Not tested SGI1 Protein 5e-25 47
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-25 47
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-25 47
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-26 47
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-25 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C770_GR4pC1257 YP_007193540.1 putative transcriptional regulator BAC0686 Protein 8e-26 48
C770_GR4pC1257 YP_007193540.1 putative transcriptional regulator BAC0688 Protein 6e-27 48
C770_GR4pC1257 YP_007193540.1 putative transcriptional regulator BAC0232 Protein 5e-26 47
C770_GR4pC1257 YP_007193540.1 putative transcriptional regulator BAC0683 Protein 2e-26 47
C770_GR4pC1257 YP_007193540.1 putative transcriptional regulator BAC0684 Protein 6e-27 47
C770_GR4pC1257 YP_007193540.1 putative transcriptional regulator BAC0687 Protein 5e-26 47
C770_GR4pC1257 YP_007193540.1 putative transcriptional regulator BAC0689 Protein 7e-26 47