Gene Information

Name : B938_01340 (B938_01340)
Accession : YP_007184978.1
Strain : Bacillus amyloliquefaciens AS43.3
Genome accession: NC_019842
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 281083 - 281661 bp
Length : 579 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCTATTCAATTGGCGAAAGGACAGCGTGTTGATCTGACAAAAACGAACCCCGGCCTTACAAAAGCGGTGATCGGTTT
AGGCTGGGATACGAACAAGTACTCCGGAGGGCATGACTTTGACCTTGACGCGTCGGCTTTTCTTGTCGATGCCCATGACA
ACTGTGTAAATGATCTTGATTTTGTTTTCTACAATAACCTGGAACACCCAAGCGGGGGCGTCATCCATACGGGAGACAAC
CGGACGGGCGAGGGCGAGGGAGACGATGAACAAATTATCGTCGACTTCTCAAAAATACCCGCAAATATTGAAAAGATCGG
CATCACCGTCACGATTCATGATGCGGAAGCGCGCGGCCAAAATTTCGGACAAGTTTCGAACGCGTTCGTGCGCGTCGTCG
ATGAAAACAGCCAGAATGAACTGCTTCGTTTCGATTTAGGGGAAGACTTCTCGATTGAAACGGCGGTTGTCGTTTGTGAG
CTTTACCGCCATGGGGCTGAGTGGAAGTTTAACGCCATCGGCAGCGGGTTTTCCGGCGGTCTGGCATCACTTTGCCGGAA
TTACGGCTTGCAGGTGTAA

Protein sequence :
MAIQLAKGQRVDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGEGDDEQIIVDFSKIPANIEKIGITVTIHDAEARGQNFGQVSNAFVRVVDENSQNELLRFDLGEDFSIETAVVVCE
LYRHGAEWKFNAIGSGFSGGLASLCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-53 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-51 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B938_01340 YP_007184978.1 tellurium resistance protein BAC0390 Protein 2e-51 55
B938_01340 YP_007184978.1 tellurium resistance protein BAC0389 Protein 2e-51 53