Gene Information

Name : B938_01335 (B938_01335)
Accession : YP_007184977.1
Strain : Bacillus amyloliquefaciens AS43.3
Genome accession: NC_019842
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 280469 - 281050 bp
Length : 582 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAATTTCATTGGCAAAAGGACAAAAAGTAGATTTGACTAAAACAAATCCGGGTCTTTCTAAAGTCGTTGTCGGCCT
TGGCTGGGATACAAACAAATACGACGGCGGACATGATTTTGATTTAGATTCCAGCGTCTTTCTATTAAATGAAGCAGGAA
AATGCGCGTCGCCCGATGATTTCATTTTCTATAATCAGCTTGAAGGCGGAAACGGCTCTGTCGCACATTCAGGCGACAAC
CTGACAGGCCAGGGCGAAGGCGATGACGAAAGCGTAAGAGTCAACCTGAGCGCGGTGCCCGCGGCTATTGACAAAATTTC
ATTCGTCATCACGATTCATGAAGCGGAAGCGCGCGGCCAAAACTTCGGACAAGTTTCCAACGCGTTCGTGCGCATTGTCA
ATGAAGAGACAAATGAGGAGCTGATCCGCTACGATCTGGCTGAAGATTTCTCAATTGAAACAGCCATTATCGCAGGGGAG
CTTTACAGACATAACGGCGAATGGAAATTTTCCGCGATCGGCTCAGGCTACCAAGGCGGACTGGCCCGTATTGCGACAGA
TTACGGCCTGCAAATCGGCTGA

Protein sequence :
MAISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLNEAGKCASPDDFIFYNQLEGGNGSVAHSGDN
LTGQGEGDDESVRVNLSAVPAAIDKISFVITIHEAEARGQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-56 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-55 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-56 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-56 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-47 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-46 51
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-46 51
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-46 51
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B938_01335 YP_007184977.1 hypothetical protein BAC0389 Protein 9e-56 58
B938_01335 YP_007184977.1 hypothetical protein BAC0390 Protein 4e-51 54
B938_01335 YP_007184977.1 hypothetical protein BAC0392 Protein 7e-28 41