Gene Information

Name : Deipe_1961 (Deipe_1961)
Accession : YP_007181230.1
Strain : Deinococcus peraridilitoris DSM 19664
Genome accession: NC_019793
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1966127 - 1966702 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGAGCATCACCCTTACCAAAGGCGGCAACCTTTCGCTGACCAAGACCGACGCCACCCTCACCAAGATCAGCGTGGGCCT
CGGCTGGGACACCCGCTCTACCAGCGGCGACGACTTCGACCTCGACGCCAGCGCCTTTCTGCTGAATGCCAGCGGCAAGA
CCCGCTCCACGGCGGATTTCATTTTCTACAACCAGCTGCGCAGCGCCGAGGGCAGCGTCGAGCACGCCGGGGACAACCGC
ACCGGGGCAGGTGACGGCGACGACGAGGTGATCCGGGTGGATCTCGCCCTGGTCCCGTCCGACGTGGAACGCGTCGCCTT
CACGGTGACCATTCACGAAGCGCAGGCGCGCCGCCAGAGTTTCGGCATGGTCGAAAACGCCTTCGTGCGCATCGTGGACG
AGCGCAACAACAAAGAAGTCGTGCGCTACGACCTGCGCGAGGACGCCAGCGTCGAAACGGCGCTGATTTTCGCAGAACTC
TACCGTCACGGCGGAGAGTGGAAGTTCCGCGCGGTCGGGCAGGGCTTTGCGGGCGGTCTGCAGGCCCTGTGTCATCATTT
CGGCATCAACATCTGA

Protein sequence :
MSITLTKGGNLSLTKTDATLTKISVGLGWDTRSTSGDDFDLDASAFLLNASGKTRSTADFIFYNQLRSAEGSVEHAGDNR
TGAGDGDDEVIRVDLALVPSDVERVAFTVTIHEAQARRQSFGMVENAFVRIVDERNNKEVVRYDLREDASVETALIFAEL
YRHGGEWKFRAVGQGFAGGLQALCHHFGINI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 71
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-56 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-56 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-56 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-49 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-49 57
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-49 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-47 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1961 YP_007181230.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 3e-56 65
Deipe_1961 YP_007181230.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 1e-51 60