Gene Information

Name : Deipe_1685 (Deipe_1685)
Accession : YP_007180979.1
Strain : Deinococcus peraridilitoris DSM 19664
Genome accession: NC_019793
Putative virulence/resistance : Virulence
Product : CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1683419 - 1684078 bp
Length : 660 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence : 
GTGGTCGATGACGATCCCGGCATCCTGGAAGTGCTGCGCTTGTACCTGGAGGCCGAGCAGCACCACGTGCTGGAAGCCAG
GGATGGCCTCTCCGCGCTTGACCTGCTCGCGCAGGCTGACGTGGCGATCTTCGACTGGATGTTGCCACACCTCAGCGGCA
TCGAACTCACCGTGCGCGCCCGGGAACTCTACCCGGAGTTGCCAGTGATGCTGCTCACGGCGCGTGGGGAGGAAGAAGAC
CGCTTGCACGGGCTGAACACCGGAGCGGACGATTACGTCAGCAAGCCGTTCAGTCCACGTGAAGTGGTGGCGCGCGTGCA
TGCCCTGCTGCGCCGCGCCGGCGTTCGAGAAGTCCTGCAAGCGGGGCCGCTCAGTCTGAGCCTTCAGACGCGTGTTGCGA
CGCTCAACGGCACGCCGCTCGATTTATCCAAGCTGGAGTTCGATCTGCTCGTCACGCTCGCGCAGCACCCCGGCCTGGTC
TGGACGCGTGAGCGACTGGTGGAGCGCGTCTGGGGTGTAGATTACCCGGGTACCGCACGTGTGGTGGACGTACAAATCAC
GAACCTGCGTAAACGCCTCGCCGACGATCCCGACCATCCGCGCTTCATTGAAACCGTCCGCGGCGTGGGGTACAAATTCA
AAGCGGACGTTCCAGGATAG

Protein sequence : 
MVDDDPGILEVLRLYLEAEQHHVLEARDGLSALDLLAQADVAIFDWMLPHLSGIELTVRARELYPELPVMLLTARGEEED
RLHGLNTGADDYVSKPFSPREVVARVHALLRRAGVREVLQAGPLSLSLQTRVATLNGTPLDLSKLEFDLLVTLAQHPGLV
WTRERLVERVWGVDYPGTARVVDVQITNLRKRLADDPDHPRFIETVRGVGYKFKADVPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 8e-24 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_012469.1.7685629. Protein 2e-33 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002952.2859905.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_009782.5559369.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002951.3237708.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002758.1121668.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_009641.5332272.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_013450.8614421.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007793.3914279.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_003923.1003749.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_007622.3794472.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002745.1124361.p0 Protein 8e-34 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator CP001918.1.gene5135. Protein 2e-22 42
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator NC_002695.1.915041.p Protein 1e-22 41
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator CP000034.1.gene3834. Protein 1e-22 41
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator CP001138.1.gene4273. Protein 3e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1685 YP_007180979.1 CheY-like receiver domain/winged-helix DNA-binding domain-containing response regulator VFG1389 Protein 6e-30 42