Gene Information

Name : Deipe_1395 (Deipe_1395)
Accession : YP_007180703.1
Strain : Deinococcus peraridilitoris DSM 19664
Genome accession: NC_019793
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1415307 - 1415882 bp
Length : 576 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCAGTTTCACTGAAAAAAGGCGGGAACGTCAGTCTCACCAAAGAAGCCCCCACCATGAAGAGGCTCACCCTCGGGCT
CGGCTGGGACCCACGCAAGACCGACGGTCAGAAGTTCGACCTCGACGCGATGGTGTTTCTGCTCGGCGCCAACGGGCAGG
TGCGCTCGGATGCCGACTTCATCTTCTTCAACAACACCCAGAGCACTGACGGCAGCGTCGTTCACGCGGGCGACAACCGC
TCCGGCGAAGGAGAGGGTGACGACGAAACCATCGAAATCAACCTCGAAAAAGTTCCGTCGGACGTCGACAAGATCGTGGC
AAGTGTGGTGATTTACGAAGGCCAGGCGAACAACCAGAACTTCGGCATGGTCGACAAGGCCTACATCCGCGTGGTGAATG
CCGACGGCGGCACGGAAGTCGCCCGCTATGACCTGACCGAGGACGGCGGCACCGTCACCGCCATGATCTTCGGTGAGCTG
TACCGCCACAATGGCGAGTGGAAGTTCAAGGCGCGCGGCGAAGGATACGACGCAGGCTTTCAGGCGCTGGTAAAGAGTTA
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLKKGGNVSLTKEAPTMKRLTLGLGWDPRKTDGQKFDLDAMVFLLGANGQVRSDADFIFFNNTQSTDGSVVHAGDNR
SGEGEGDDETIEINLEKVPSDVDKIVASVVIYEGQANNQNFGMVDKAYIRVVNADGGTEVARYDLTEDGGTVTAMIFGEL
YRHNGEWKFKARGEGYDAGFQALVKSYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 63
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-51 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-54 63
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-54 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-48 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deipe_1395 YP_007180703.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 7e-54 64
Deipe_1395 YP_007180703.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 1e-52 62