Gene Information

Name : Dacsa_1603 (Dacsa_1603)
Accession : YP_007171635.1
Strain : Dactylococcopsis salina PCC 8305
Genome accession: NC_019780
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1617648 - 1618241 bp
Length : 594 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGGAATTAATCTACAAAAGGGACAACGGATTTCACTGAAAAAAGAAGCACCTAGCTTAAAAAAATTGATGTGTGGTTT
AGGTTGGGATGTGGTCGATCGATCTAGCGGTTTGACTTCAATGTTTAAGGCCGATTATGATCTAGATGCTTCGGTTTTAT
GTCTAGATCAAAATGATAAGCTCAAAGGCAATTCTAACGTCGTTTATTTTGGTAATCTCAGCCATCAATCAGGCGCAATT
ACCCATCTTGGGGATAATCTCACAGGAGAAGGAGAAGGGGATGATGAACAAATTATTGTTGATTTACCGAATGTTCCCGC
AGAAATTTCTAAATTAGTATTTGTAGTTAATATCTATGATGCAGTGAAGCGCAAACATGATTTTGCTCAAGTAGAAAATG
CTTTTGTGCGTTTAGTTGATGTGTCTAATAATCAAGAAATTGCTCGTTATACCCTTTCTGGAAATGATTATCAAGGAAAA
ACCAGCATGATTTTAGGGGAAGTTTATCGCCAAGATGACGAATGGAAAATGGCAGCAATTGGCAATGGTTTAGAACTGAA
CGGGTTACAAGAAGTCGTTAATCATTATTTGTAG

Protein sequence :
MGINLQKGQRISLKKEAPSLKKLMCGLGWDVVDRSSGLTSMFKADYDLDASVLCLDQNDKLKGNSNVVYFGNLSHQSGAI
THLGDNLTGEGEGDDEQIIVDLPNVPAEISKLVFVVNIYDAVKRKHDFAQVENAFVRLVDVSNNQEIARYTLSGNDYQGK
TSMILGEVYRQDDEWKMAAIGNGLELNGLQEVVNHYL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-39 45
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-39 45
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-39 44
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-37 43
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-37 43
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-37 43
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-36 43
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dacsa_1603 YP_007171635.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 2e-36 44
Dacsa_1603 YP_007171635.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 1e-38 43