Gene Information

Name : Cyast_1974 (Cyast_1974)
Accession : YP_007165576.1
Strain : Cyanobacterium stanieri PCC 7202
Genome accession: NC_019778
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2194016 - 2194591 bp
Length : 576 bp
Strand : +
Note : PFAM: Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cyt:cce_2527 stress protein; PFAM: stress protein; SPTR: Tellurium resist

DNA sequence :
ATGGGTATTTCACTAGAAAAAGGACAAAGAATTTCATTAACTAAAGTAGCGCCAAGTTTAGTCGCTGGATTTATCGGATT
AGGTTGGGATGTGAATACCACCGACACAGGGGGCGATTTTGACCTAGACGCATCAGTATTTTTGTTAGGAGATAATGAAA
AAATTGTTTCTGATAAACATTTTATTTTTTACAATAACTTAGTTAGTCCAGATCCAGATCATTCTGTCAAACTTTTGGGT
GATAATCGCACAGGAGAAGGAGATGGCGATGATGAGGGATTAATTGTGGATTTGAGAAAAATTCCCCCTGAAGTAAAAAA
AATCGTCGTCACCGTGACTATTTACGAAGCCGATAAAAGAAAACAAAATTTTGGTCAGGTAAATAATGCTTATATTCGTT
TAGTGGATGTACAAACCAAAGAGGAAGTTTTACGCTACGACTTGAGCGAAGATTTTTCTGTGGAAACTGCCGTTATTATG
GCGGAACTATACCATCAGGAGGGCGATTGGCGTATTAACGCCGTGGGTTCTGGTTTCCAAGGCGGTTTACAAGCACTATT
AGATCGATATAGTTAA

Protein sequence :
MGISLEKGQRISLTKVAPSLVAGFIGLGWDVNTTDTGGDFDLDASVFLLGDNEKIVSDKHFIFYNNLVSPDPDHSVKLLG
DNRTGEGDGDDEGLIVDLRKIPPEVKKIVVTVTIYEADKRKQNFGQVNNAYIRLVDVQTKEEVLRYDLSEDFSVETAVIM
AELYHQEGDWRINAVGSGFQGGLQALLDRYS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-46 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-46 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-47 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-47 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-45 52
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-45 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-45 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-43 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyast_1974 YP_007165576.1 stress protein BAC0390 Protein 8e-48 56
Cyast_1974 YP_007165576.1 stress protein BAC0389 Protein 9e-46 54