Gene Information

Name : Cyan10605_3415 (Cyan10605_3415)
Accession : YP_007163501.1
Strain : Cyanobacterium aponinum PCC 10605
Genome accession: NC_019776
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4034162 - 4034737 bp
Length : 576 bp
Strand : +
Note : PFAM: Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cyt:cce_2527 stress protein; PFAM: Bacterial stress protein; SPTR: Stress

DNA sequence : 
ATGACTATTTCACTAAAAAAAGGCGAAAGAATTTCCTTAGCTAAAGTTGCCCCTAGCCTAGTTGCAGGATTTATCGGTTT
GGGTTGGGATGTCAATGTTACAGATACTGGCGGTGATTTTGATTTAGATGTATCTGTTTTTCTATTAGGAGACAATGACA
AATTAGTTTCCGATAAACACTTCATTTTTTACAATAACCTAGTTAGTCCCGATTCTGATCAATCTGTTAAACTTTTAGGA
GATAACCGCACTGGTGAAGGAGAGGGAGACGATGAAGGTTTAATTGTCGATTTACGTAAAGTTCCCGTAGATGTAGCTAA
AATAGTGGTAACGGTGACAATTTACGAAGCTGACAAGAGAAAACAAAATTTTGGTCAAGTTAGTAATGCTTATATCCGTC
TAGTGGATGTACAAACGAAAGAAGAAGTTTTGCGCTACGATTTGACAGAAGACTTCTCCGTAGAAACTGCAGTAATTATG
GCAGAATTGTACAGAAAAGACGGGGAATGGCGACTTAATGCAGTTGGTTCTGGTTTTCAAGGGGGATTACAAGCCCTTTT
AGATAGATACAATTAA

Protein sequence : 
MTISLKKGERISLAKVAPSLVAGFIGLGWDVNVTDTGGDFDLDVSVFLLGDNDKLVSDKHFIFYNNLVSPDSDQSVKLLG
DNRTGEGEGDDEGLIVDLRKVPVDVAKIVVTVTIYEADKRKQNFGQVSNAYIRLVDVQTKEEVLRYDLTEDFSVETAVIM
AELYRKDGEWRLNAVGSGFQGGLQALLDRYN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-46 55
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-47 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-47 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-47 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-45 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-45 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-45 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-43 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_3415 YP_007163501.1 stress protein BAC0390 Protein 1e-47 58
Cyan10605_3415 YP_007163501.1 stress protein BAC0389 Protein 7e-46 55