Gene Information

Name : Cyan10605_2543 (Cyan10605_2543)
Accession : YP_007162667.1
Strain : Cyanobacterium aponinum PCC 10605
Genome accession: NC_019776
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3024263 - 3024949 bp
Length : 687 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: syf:Synpcc7942

DNA sequence :
ATGACTAATTCAATTCTTGTAGTGGAAGATGATCAAAGACTATCTCAATTTATCGTCACTGAATTAAAATTAGAAGGCTA
TGAAGTGGCGACTGCTGATGATGGCATGGAAGCCTTAGAAAAAGTGAGAGAATTTCCTCCTGATTTAATTATCCTTGATT
GGATGTTACCGAGAATCTCCGGGTTAGATGTCTGTTTGCGATTGCGCAAAACGGGTATTAAAATCCCTATTATATTATTA
ACTGCCAGAGATGAAATTCCCGATCGAGTTTTGGGCTTAAATTCTGGTGCAGATGATTATTTAACCAAACCTTTTAGTAT
TGAAGAATTGTTGGCAAGAATTAATGCTCGTCTGCGTAGTAGTCAAGTAAATGATACCTCAGAAATTCTCCAATTTGCAG
ACTTAAAACTGAATCTCTTAACTAGAGAAGTATTCAGGAGTAAGGATTCGATTGAACTAACGGCAAAAGAATTTGATCTA
TTAGAATATTTATTAAGACATCCCCGTCAAGTATTAAGTAGAAATCAAATTATCGAAAATGTCTGGGATTTTGACTTTAT
GGGAGAATCAAATATTATTGAGGTTTATATTCGGGCATTAAGACTCAAATTAGAAGTCAATCAATCCCCTCGTTTAATTC
ATACTGTCAGAGGAGTTGGTTATGTGTTAAAAGACTCTCCTTCTTAG

Protein sequence :
MTNSILVVEDDQRLSQFIVTELKLEGYEVATADDGMEALEKVREFPPDLIILDWMLPRISGLDVCLRLRKTGIKIPIILL
TARDEIPDRVLGLNSGADDYLTKPFSIEELLARINARLRSSQVNDTSEILQFADLKLNLLTREVFRSKDSIELTAKEFDL
LEYLLRHPRQVLSRNQIIENVWDFDFMGESNIIEVYIRALRLKLEVNQSPRLIHTVRGVGYVLKDSPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-30 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-43 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-39 45
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-40 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-41 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-41 44
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-37 43
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-37 43
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-39 43
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-37 43
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-36 42
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-36 42
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-38 42
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-34 42
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-36 41
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-54 51
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-40 46
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-30 42
Cyan10605_2543 YP_007162667.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-43 42