Gene Information

Name : Cyan10605_2326 (Cyan10605_2326)
Accession : YP_007162454.1
Strain : Cyanobacterium aponinum PCC 10605
Genome accession: NC_019776
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2776481 - 2777182 bp
Length : 702 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cyt:cce_1725 t

DNA sequence :
ATGGAAATTTTAATTGTTGAAGACGAAAGGGAAATCGCCCAATTGATTAATAGTTGTTTAAGTCGAGAGGGTTTTACTTG
TCATCATGCTTATGATGGAGTCACTGCCCTTCAACAGGCTCAAACTATTCAACCAGACTTAATTATTCTCGATTTGATGT
TACCCCAATTAGATGGATTGGAAGTGTGTACTCGCATTCGTAATCAAGGCATGACAAAAGACCCTTATATTCTCATGTTA
ACTGCAAAAGGAGAAGAGCTCGATCGCATCATTGGTTTATCGACAGGGGCAGATGATTACTTAGTAAAACCTTTTAGCCC
CAGAGAATTAGTTGCCAGAGTTAGGGCATTGCTACGCCGTAGTTTACGCCACGAAAAACAGTCACAAATATATGAAACCC
CCCACTTTATACTCAATTTAGACGAACATATCGCCACCCGCAAACTAGAGAATCAACCCCCGGAAGAATTAGACTTAACC
GCCCTTGAATTTAATCTACTTTCTGCCTTCATTAGTTATCCTGGAAAAGTTTGGAGTAGAGAGCAGTTAATTGATAAACT
ATGGGGAGCAGATTTTTTTGGAGATGAAAGAGTCGTTGATACTCACATTCGCCGTTTACGCAAAAAAATTGAACCTAATC
CTGCTCAACCTTCTTTTATTAAAACCGTTGTCGGTGTAGGCTACAAATTTGAAGATAATTAA

Protein sequence :
MEILIVEDEREIAQLINSCLSREGFTCHHAYDGVTALQQAQTIQPDLIILDLMLPQLDGLEVCTRIRNQGMTKDPYILML
TAKGEELDRIIGLSTGADDYLVKPFSPRELVARVRALLRRSLRHEKQSQIYETPHFILNLDEHIATRKLENQPPEELDLT
ALEFNLLSAFISYPGKVWSREQLIDKLWGADFFGDERVVDTHIRRLRKKIEPNPAQPSFIKTVVGVGYKFEDN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-22 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-36 47
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator BAC0596 Protein 5e-27 45
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 5e-27 45
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-35 44
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-35 44
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-31 43
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-28 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-28 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-28 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-27 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-27 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-27 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-27 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-27 42
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-35 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-29 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-29 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-26 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-28 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-33 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 9e-26 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-22 41
Cyan10605_2326 YP_007162454.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-23 41