Gene Information

Name : Cyan10605_1905 (Cyan10605_1905)
Accession : YP_007162047.1
Strain : Cyanobacterium aponinum PCC 10605
Genome accession: NC_019776
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2284782 - 2285357 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cyt:cce_2527 stress protein; PFAM: Bacterial stress protein; SPTR: Stress

DNA sequence :
ATGGCAATTTCATTACAAAAAGGGCAAAGAGTCTCACTAGATAAAGTTGCCCCCGGATTAAATGCGGCTTTCATCGGCTT
AGGTTGGGATGTAAATACAACAGATACAGGAGTGGATTTTGACTTAGATGCCTCTGTTTTTCTGCTCAATAGCAATGAAA
AGCTAATTTCTGACCAACATTTTATCTTTTATAATAATCTCACAAGTCCAGACCCTGAAAAATCTATTAAACACATGGGA
GATAATCTCACAGGAGAAGGAGACGGAGATGACGAAGTTATTATCGTTGACTTAAGAAAAGTACCAACAGATGTCAATCG
TATAGTTGTAACTGTAACTATTTATGATGCAGATAAGAGAAAACAAAATTTTGGTCAAGTCAGAAACGCCTTTGTCAGAT
TAGTAAATGTAGAAACCAAAGAAGAAGTTTTACGCTATGACTTAGAAGAAGACTTTTCCACAGAAACCGCTTTAATTATG
GCAGAAATTTACCGCAAAGATGGTGAATGGCGTATGAATGCCGTTGGGGCTGGTTATCAAGGAGGTTTACAGGCTTTACT
CAATCGTTATCAATAA

Protein sequence :
MAISLQKGQRVSLDKVAPGLNAAFIGLGWDVNTTDTGVDFDLDASVFLLNSNEKLISDQHFIFYNNLTSPDPEKSIKHMG
DNLTGEGDGDDEVIIVDLRKVPTDVNRIVVTVTIYDADKRKQNFGQVRNAFVRLVNVETKEEVLRYDLEEDFSTETALIM
AEIYRKDGEWRMNAVGAGYQGGLQALLNRYQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-44 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-43 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-43 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-43 57
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-40 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-38 54
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_1905 YP_007162047.1 stress protein BAC0390 Protein 3e-43 58
Cyan10605_1905 YP_007162047.1 stress protein BAC0389 Protein 6e-43 56