Gene Information

Name : Cyan10605_1904 (Cyan10605_1904)
Accession : YP_007162046.1
Strain : Cyanobacterium aponinum PCC 10605
Genome accession: NC_019776
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2283938 - 2284534 bp
Length : 597 bp
Strand : -
Note : PFAM: Tellurium resistance protein; Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cyh:Cyan8802_2121 stress protein; PFAM: Bac

DNA sequence : 
ATGGGAATTAATTTACAAAAAGGACAAAGAATTTCACTAAAAAAAGAAGCCCCTAAATTAGAACAACTAATGTGTGGTTT
AGGTTGGGATGTCGCCAAGAAAAAAGGCGGTTTTTTAAGTGGTTTGTTTACCACAGATTTTGATTTAGATGCTTCGGTTT
TATGTTTGAATCAAGATGGTAAAATAAAATCAAATAGTGAAATCGTTTTCTTCGGCAATTTACGTCATTATTCTGATGCG
ATTAATCACATGGGAGATAATCTGACTGGCGCCGGAGATGGTGATGATGAACAAATATTAGTCAAATTACCTTTGATTCC
TCAAAATATTCACAAATTAGTTTTTGTGGTTAATATTTATAATGCCTTAGAAAGAAGTCAAGATTTTTCCCAAGTAGAAA
ATGCTTTTGTGCGTTTGGTTAACTTAAGCAATAATCAGGAAATCGCTCGTTATACTCTCTCTGGAAATGGTTATCAAGGA
AAAACAGGGATGATTATGGCAGAAATTGCCCGTGTAGGTGACGATTGGGAAATGATGGCAAAAGGTGAAGGTTTTCAGGT
AAAAAGTTTGGGTGATGTAATGAAACTTTATAGTTAA

Protein sequence : 
MGINLQKGQRISLKKEAPKLEQLMCGLGWDVAKKKGGFLSGLFTTDFDLDASVLCLNQDGKIKSNSEIVFFGNLRHYSDA
INHMGDNLTGAGDGDDEQILVKLPLIPQNIHKLVFVVNIYNALERSQDFSQVENAFVRLVNLSNNQEIARYTLSGNGYQG
KTGMIMAEIARVGDDWEMMAKGEGFQVKSLGDVMKLYS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-30 44
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-32 44
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-32 44
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-32 44
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-32 42
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-34 42
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-33 41
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_1904 YP_007162046.1 stress protein BAC0390 Protein 7e-31 43