Gene Information

Name : Cyan10605_1850 (Cyan10605_1850)
Accession : YP_007161996.1
Strain : Cyanobacterium aponinum PCC 10605
Genome accession: NC_019776
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2214130 - 2214801 bp
Length : 672 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cyt:cce_0817 t

DNA sequence :
ATGAGTAAGATTTTAGTGGTAGAAGATGAGCAAAAATTAGCTAAGTTTTTGGAGTTAGAGTTGCAATATGAAGGCTATGA
AGTTGCGATCGCACCAGATGGAAAAGAAGGATTAAAGGTTGCTCAAAAAATTAATCCTGACCTGATTTTGCTAGACTGGA
TGTTACCCCAAATGTCTGGTTTTGATGTTTGTCGTCAGTTACGTAGTTTAGGCTGCATGATTCCTATTATCCTTTTAACT
GCAAGGGATGAAATCAATGATCGTGTGGCTGGTTTAGATGCAGGGGCGGATGATTATATTGTTAAACCTTTTGGTATTGA
AGAATTATTATCTAGGTTACGAGTCCATTTACGCAAAAGCAATGAAGAAGACCCCGACGAACTACACTTTCTTGATTTGA
GCTTGAATCGTCGTACCCGTGAAGTAAAAAGAGGCGATCGCATCATCGATTTAACCGCTACGGAATATGACTTAATGGAA
TATTTAATTTCCCACCCTCGACAAGTATTAACTCGTGATCAAATTTTAGAAAAAGTTTGGGGTTATGATTTTGGCGGAGA
TTCTAATATCATTGAAGTATATGTAAGATACCTGCGACTGAAATTAGAATCGAATAAGGAAAAAAGAATTATTCAGACTG
TTAGAGGCGTAGGCTATGTGTTGAAAGATTAA

Protein sequence :
MSKILVVEDEQKLAKFLELELQYEGYEVAIAPDGKEGLKVAQKINPDLILLDWMLPQMSGFDVCRQLRSLGCMIPIILLT
ARDEINDRVAGLDAGADDYIVKPFGIEELLSRLRVHLRKSNEEDPDELHFLDLSLNRRTREVKRGDRIIDLTATEYDLME
YLISHPRQVLTRDQILEKVWGYDFGGDSNIIEVYVRYLRLKLESNKEKRIIQTVRGVGYVLKD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-34 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-49 51
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-44 49
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-48 48
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-40 45
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-28 44
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-36 43
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-40 43
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-38 43
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-40 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-41 42
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-41 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-57 53
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-48 43
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-41 43
Cyan10605_1850 YP_007161996.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-34 41