Gene Information

Name : Cylst_4172 (Cylst_4172)
Accession : YP_007148955.1
Strain : Cylindrospermum stagnale PCC 7417
Genome accession: NC_019757
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4722964 - 4723644 bp
Length : 681 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGACGCACATCTTACTGGTTGAAGATGAAGTCAAATTGGCTCGATTTGTAGAATTGGAACTGAATTATGAAGGCTATCA
AGTCAGCGTCGCCTACGATGGATTAACCGCACTTACCGCAGCGCGAGAGTTGCGTCCGGATTTAGTCATTTTAGACTGGA
TGCTGCCTGGTGTATCGGGGTTGGAAATATGCCGCCGCTTACGAAGTACGGGTGATAAAGTACCGATAATTTTATTAACC
GCCAAAGATGAAGTAGGCGATCGCGTTGCAGGCTTAGATGCTGGTGCTGATGATTATGTAGTTAAACCCTTCAGTGTTGA
AGAACTATTAGCCAGAGTCCGGGCCCACCTGCGAAGAACCAAAGAAACCGATACCGCAGATACCTTAGAGTTTGCCGACC
TAAGTTTAAATCGTCGGACGCGAGAAGTACACCGAGGTCAGCGCTTAATTGAGTTAACCGCCAAGGAATTTGACTTACTG
GACTATTTACTAGCCCATCCGCGACAGGTAATTACGCGCGATCGCATTTTGGAAGAAGTCTGGGGTTACGACTTCATGGG
CGATTCCAACATTATTGAAGTTTACATTCGCTACTTGCGCCTGAAACTTGAAGCTAATGACGAAAAGCGCCTCCTGCAAA
CAGTGCGCGGTGTCGGCTACGTCTTGCGCGATTATGCGTAA

Protein sequence :
MTHILLVEDEVKLARFVELELNYEGYQVSVAYDGLTALTAARELRPDLVILDWMLPGVSGLEICRRLRSTGDKVPIILLT
AKDEVGDRVAGLDAGADDYVVKPFSVEELLARVRAHLRRTKETDTADTLEFADLSLNRRTREVHRGQRLIELTAKEFDLL
DYLLAHPRQVITRDRILEEVWGYDFMGDSNIIEVYIRYLRLKLEANDEKRLLQTVRGVGYVLRDYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-32 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 7e-50 51
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 4e-44 50
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 9e-45 47
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 5e-37 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 9e-42 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-41 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-39 46
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 2e-37 45
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 7e-38 45
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 5e-40 45
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 3e-34 44
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 2e-36 43
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 2e-36 42
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 9e-32 42
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-36 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 9e-41 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010400.5986590.p0 Protein 3e-30 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_011595.7057856.p0 Protein 3e-30 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 3e-32 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010410.6002989.p0 Protein 3e-30 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002516.2.879194.p Protein 3e-27 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-32 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000034.1.gene3671. Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 2e-58 57
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 2e-43 47
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 4e-34 45
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 2e-47 45
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 4e-32 41
Cylst_4172 YP_007148955.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 6e-32 41