Gene Information

Name : Cri9333_4702 (Cri9333_4702)
Accession : YP_007144991.1
Strain : Crinalium epipsammum PCC 9333
Genome accession: NC_019753
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5314044 - 5314619 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cyt:cce_2527 stress protein; PFAM: Bacterial stress protein; SPTR: Stress

DNA sequence : 
ATGGCAGTTTCACTCACAAAAGGGCAACGAGTATCGCTTGATAAAGTAGCACCAGGGCTATCTGAAGCATTCGTTGGTTT
AGGTTGGGACATTAAATCCACAGACACAGGCTATGATTTCGACCTTGATTCCTCACTATTCCTATTAGGTGCAAACGAAA
AACTTTTATCTGATAACCATTTCATTTTCTACAATAATCTCATCAGTCCAGATCCCGATAAATCAGTTCAGCACATGGGG
GATAATTTGACAGGCGCTGGTGAAGGAGATGATGAACTTATCAAAATCAACCTCAAAAAAGTACCAAACGAAATTCAAAA
AATTGTGATCTGTGTAACTATCCATGAAGCACAACAACGCAAGCAGAATTTTGGTCAAGTACAAAACGCTTTCGTCAGAT
TAGTTAATGCTCAAACTCAACAAGAATCTGTCCGTTATGACTTAGTTGAAGACTACTCCGTAGAAACAGCTTTAATCATG
GCTGAACTTTACCGCAAAGACGGCGAATGGCGGCTCAATGCAGTCGGCGCAGGGTATCAAGGCGGTTTACAAGCATTACT
AGATCGCTATAGCTAA

Protein sequence : 
MAVSLTKGQRVSLDKVAPGLSEAFVGLGWDIKSTDTGYDFDLDSSLFLLGANEKLLSDNHFIFYNNLISPDPDKSVQHMG
DNLTGAGEGDDELIKINLKKVPNEIQKIVICVTIHEAQQRKQNFGQVQNAFVRLVNAQTQQESVRYDLVEDYSVETALIM
AELYRKDGEWRLNAVGAGYQGGLQALLDRYS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-39 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-39 59
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-38 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-38 59
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-36 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-36 52
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-36 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-35 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cri9333_4702 YP_007144991.1 stress protein BAC0389 Protein 1e-38 59
Cri9333_4702 YP_007144991.1 stress protein BAC0390 Protein 3e-39 58