Gene Information

Name : Cal6303_3236 (Cal6303_3236)
Accession : YP_007138149.1
Strain : Calothrix sp. PCC 6303
Genome accession: NC_019751
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3824526 - 3825203 bp
Length : 678 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ana:alr1194 tw

DNA sequence :
ATGGCAGCATATATTCTTCTAGTAGAAGATGAAGTTAAATTGGCTCGATTTATCGAACTAGAATTAACTAGCGAAGGTTA
TGAGGTCAGAGTCGCTAATGATGGAATTACGGGTATGACTTTAGCACGAGAGTCCCCACCAGATTTAGCAATTTTAGACT
GGATGCTTCCTGGGTTAACAGGAGTAGAATTATGTCGTCGTCTACGGGCAACCGGAAGCAAAATTCCCATAATTCTTCTA
ACAGCAAAAGACGAAGTTAGTGATAGAGTTGCAGGTTTGGATGCTGGTGCGGATGATTATGTTGTTAAACCTTTTAGTAT
TGAAGAACTTTTAGCTCGAATTCGTGCCCATTTACGTCGCGTTCAAGAGGATAATTCTGATATATTACAGTTTGAAGATT
TAAAATTAAATCGTCGTACTCGTGAAGTGTTTCGCGGTGAACGTGCAATCGATTTGACAGCGAAAGAGTTTGATTTACTT
GATTATTTGATGAGTTATCCTCGTCAGGTATTTAGCCGAGAACAGATTTTAGAAAAAGTCTGGGGTTATGATTTTGTGGG
TGATTCAAATATTATAGAAGTTTATATCCGCTATGTACGTCTAAAATTAGAAGAAAATGGTGAAAAACGCTTAATTCAAA
CAGTCAGGGGTGTTGGCTATGCTTTACGTGAAAATTAA

Protein sequence :
MAAYILLVEDEVKLARFIELELTSEGYEVRVANDGITGMTLARESPPDLAILDWMLPGLTGVELCRRLRATGSKIPIILL
TAKDEVSDRVAGLDAGADDYVVKPFSIEELLARIRAHLRRVQEDNSDILQFEDLKLNRRTREVFRGERAIDLTAKEFDLL
DYLMSYPRQVFSREQILEKVWGYDFVGDSNIIEVYIRYVRLKLEENGEKRLIQTVRGVGYALREN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-34 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 41
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 5e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-45 53
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-43 51
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-45 50
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-39 45
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-35 45
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-38 44
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-40 44
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-40 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-37 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 4e-36 43
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-35 42
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-38 42
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-40 42
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-32 42
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-34 41
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 9e-43 41
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-34 41
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator BAC0288 Protein 3e-32 41
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-53 51
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-40 46
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-34 45
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-44 45
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-33 41
Cal6303_3236 YP_007138149.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-33 41