Gene Information

Name : Cal6303_1618 (Cal6303_1618)
Accession : YP_007136632.1
Strain : Calothrix sp. PCC 6303
Genome accession: NC_019751
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1909305 - 1910057 bp
Length : 753 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_3369 t

DNA sequence :
ATGCATACTAGCGAACTGACCAAGTATCCTCCCACTGCGGACTTTGGACAAACTAGCCGCGTTTTAGTGGTTGAAGACGA
AGAATTGATCAGAGAAATGCTTGTTTTAGCCCTGGAAGAAGAAGGATATGCAGTAGTAACGGCTGTTGATGGGCGTTCGG
CAGTAGACCATTTTAAAGGGTATGAGCCGAATTCGGGAGAACCACAGTTTGATTTGGTGATTTTAGATTTGATGCTACCT
TTAATTAACGGCTTGGATATCTGTCGCTTGCTGCGTCATCAAGGAAACCCTGTACCAATTTTGATGTTAAGTGCCAAAGG
TAGCGAAACCGATCGAGTTTTGGGCTTAGAAGTGGGTGCGGATGATTATCTCACCAAACCTTTTAGTGTCAGAGAATTAG
TTGCTAGATGTCGAGCCTTATTACGTCGTCAACGTCTGAGTACTGTACCTGCGACTCCCGTCTTACAATACAAAGACGTA
ATGTTGTATCCCCAAGAATGCCGGGTGGTTGTGCGAGGGCAACAGGCAAACTTATCTCCTAAAGAATTTCGACTTCTGGA
GGTATTTATGAGCTATGCTCGTCGAGTTTGGTCACGGGAACAATTACTCGATCAAGTTTGGGGTCCAGATTTTGTGGGTG
ATAGTAAGACTGTTGATGTACATATTCGCTGGTTGCGGGAGAAACTAGAACAAGATCCCAGCCGTCCTGAATATATTGTG
ACTGTGCGTGGTTTTGGCTATCGTTTTGGTTAA

Protein sequence :
MHTSELTKYPPTADFGQTSRVLVVEDEELIREMLVLALEEEGYAVVTAVDGRSAVDHFKGYEPNSGEPQFDLVILDLMLP
LINGLDICRLLRHQGNPVPILMLSAKGSETDRVLGLEVGADDYLTKPFSVRELVARCRALLRRQRLSTVPATPVLQYKDV
MLYPQECRVVVRGQQANLSPKEFRLLEVFMSYARRVWSREQLLDQVWGPDFVGDSKTVDVHIRWLREKLEQDPSRPEYIV
TVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-29 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-37 47
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-42 47
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-35 46
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-38 45
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-35 44
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-27 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-24 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-31 42
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-29 42
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-29 41
Cal6303_1618 YP_007136632.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-22 41