Gene Information

Name : Sta7437_0712 (Sta7437_0712)
Accession : YP_007131272.1
Strain : Stanieria cyanosphaera PCC 7437
Genome accession: NC_019748
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 805310 - 806050 bp
Length : 741 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cyc:PCC7424_42

DNA sequence :
GTGTGGAGTAACTTGGAAACACATAAAGAAAAAATTCTAGTTGTTGATGATGAAGCTAGCATCCGTCGTATTTTGGAAAC
ACGGTTGTCCATGATTGGTTACGACGTGGTAACTGCTGCTGATGGAGAAGAAGCTCTAGAAACTTTTCGCGTTGCTGAAC
CAGATCTTGTCGTTTTGGATGTCATGATGCCCAAATTAGACGGATATGGTGTTTGTCAAGAATTGCGAAAAGAATCTGAT
ATTCCTATTATCATGTTAACTGCTTTAGGAGATGTCGCCGATCGCATTACAGGTTTAGAATTGGGTGCAGATGATTATGT
CGTCAAACCCTTTTCTCCCAAGGAGTTAGAAGCCCGAATTCGCTCTGTTTTGCGTCGAGTTGAAAAAAATGGTGCGCCAG
GCATTCCTAGTTCGGGTGTGATTCATATCGGTTCGATCAAAATCGATACCAACAAACGACAGGTATATAAGGGAGATGAA
AGAATTCGTCTCACTGGAATGGAGTTTAGTTTGCTAGAATTACTGGTTAGTCGTTCTGGTGAGCCTTTTTCCCGTTCAGA
AATTTTACAAGAAGTTTGGGGTTATACTCCCGAACGTCATGTAGATACTCGCGTAGTTGATGTTCATATTTCGCGTCTTA
GAGCTAAATTAGAAGACGATCCGAGCAATCCCGAATTGATTCTCACTGCTAGGGGAACGGGCTATCTTTTTCAACGTATT
CTCGAACCAGGAGAAGACTGA

Protein sequence :
MWSNLETHKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRVAEPDLVVLDVMMPKLDGYGVCQELRKESD
IPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVEKNGAPGIPSSGVIHIGSIKIDTNKRQVYKGDE
RIRLTGMEFSLLELLVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRI
LEPGED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 6e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-47 50
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-43 46
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-41 46
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-38 45
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-43 45
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 2e-39 45
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family BAC0083 Protein 7e-36 42
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 3e-25 42
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family BAC0197 Protein 8e-34 42
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-28 42
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-36 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-35 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 1e-37 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-30 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 5e-32 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-33 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-40 41
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-39 44
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-30 43
Sta7437_0712 YP_007131272.1 two component transcriptional regulator, winged helix family VFG1389 Protein 7e-33 42