Gene Information

Name : Sta7437_4236 (Sta7437_4236)
Accession : YP_007134675.1
Strain : Stanieria cyanosphaera PCC 7437
Genome accession: NC_019748
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4761720 - 4762298 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cyp:PCC8801_2078 stress protein; PFAM: Bacterial stress protein; SPTR: St

DNA sequence : 
ATGGCTATATCTCTACAAAAAGGACAGCGAGTTTCACTAGAAAAAGTAGCACCTGGACTAGAAGCGGTTTTAGTAGGTTT
AGGATGGGATATCAATCGAACAGACTCAGGTGTAGATTTCGATTTAGATACTTCTGTTTTCCTGTTGGGAAGTAATGAAA
AGATTTTGACAGAAAACCATTTTATCTTTTATAACAATCCCAAAAGCCCAGAACAACCTCCTTCGGTAGAGTATATGGGA
GATAATAGAACAGGACAAGGAGAAGGGGATGATGAAGTAATTCTAGTCAACCTTACCAAGATACCAAATGAGGTTGAAAA
ACTAGTATTTACAGTTACGATTTATGAAGCAGATCAACGCAGACAAAACTTTGGACAAGTACATAATGCATTTGTAAGAC
TTGTAGATGTGAAAACCAAACAAGAAGTTTTGCGCTATGACCTAGCCGAAGATTATTCCATTGAAACTGCATTAATTATG
GCAGAGCTTTATCGCAAAGATGGTACATGGCGAATGAGTGCAGTTGGCGCGGGTTATCAAGGAGGATTAGAGGCTTTATT
AAATCGCTACCATAGTTAA

Protein sequence : 
MAISLQKGQRVSLEKVAPGLEAVLVGLGWDINRTDSGVDFDLDTSVFLLGSNEKILTENHFIFYNNPKSPEQPPSVEYMG
DNRTGQGEGDDEVILVNLTKIPNEVEKLVFTVTIYEADQRRQNFGQVHNAFVRLVDVKTKQEVLRYDLAEDYSIETALIM
AELYRKDGTWRMSAVGAGYQGGLEALLNRYHS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-48 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-48 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-48 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-45 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-47 51
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-47 51
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-47 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sta7437_4236 YP_007134675.1 stress protein BAC0390 Protein 1e-49 54
Sta7437_4236 YP_007134675.1 stress protein BAC0389 Protein 4e-49 54