Gene Information

Name : Glo7428_0219 (Glo7428_0219)
Accession : YP_007125988.1
Strain : Gloeocapsa sp. PCC 7428
Genome accession: NC_019745
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 244387 - 245097 bp
Length : 711 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_1944 t

DNA sequence :
ATGGATATATTAATTGTTGAGGATGAAGCTGAAATTGCTGGATTGATTCAACTGGCGCTAGAAAAAGAAGGATTTTCCTG
TCAAAGTTGCCGTGATGGACTCGCGGCTTTGCGCTTATTTCAAGAGTTACAGCCCGATCTAATTATCCTCGACTTGATGC
TCCCTGGTTTGGACGGACTCGAAGTATGTGCCAGAATTCGCCAAAAACCTGGCACTAAAGATCCTTACATACTGATGCTG
ACCGCTAGAGGTGAGGAAATTGACCGCGTGATTGGTTTATCTACAGGTGCAGATGATTACCTCGTTAAGCCTTTTAGTCC
TAGAGAGTTAGTGGCACGAGTGCGGGCGTTGTTGCGGCGGAGTTTGCGCCAAGGCGGACAACATCAAATTCATCGCACGC
AACATTTTATCGTAGATGTAGAACAACGTTCTGCCAGTCGTCAAGTGAGTAGCGATCGCACTGAAGAATTAGACCTGACA
ACCTTGGAATTTAACTTACTCAGCACCTTTGTCAGCAATCCTGGTCGAGTGTGGAACCGCACGCAGTTAATCGATAAACT
TTGGGGTAGCGACTTTTTCGGCGATGAACGCGTTGTCGATACTCACGTTGCCCGATTGCGAAAAAAAATCGAACCCGATC
CTGCCAATCCCACGTTTATTAAAACGGTTGTTGGTGTCGGCTACAAATTTGAAGACGCAGCAACGTCATAA

Protein sequence :
MDILIVEDEAEIAGLIQLALEKEGFSCQSCRDGLAALRLFQELQPDLIILDLMLPGLDGLEVCARIRQKPGTKDPYILML
TARGEEIDRVIGLSTGADDYLVKPFSPRELVARVRALLRRSLRQGGQHQIHRTQHFIVDVEQRSASRQVSSDRTEELDLT
TLEFNLLSTFVSNPGRVWNRTQLIDKLWGSDFFGDERVVDTHVARLRKKIEPDPANPTFIKTVVGVGYKFEDAATS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-26 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 7e-36 46
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-36 45
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 1e-29 44
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 2e-30 44
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 2e-30 44
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-35 44
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-34 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-36 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 2e-28 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 2e-28 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 2e-28 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 1e-28 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family BAC0039 Protein 2e-28 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 4e-27 41
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family BAC0596 Protein 4e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family VFG1702 Protein 7e-27 42
Glo7428_0219 YP_007125988.1 two component transcriptional regulator, winged helix family VFG1563 Protein 5e-27 41