Gene Information

Name : Glo7428_1879 (Glo7428_1879)
Accession : YP_007127588.1
Strain : Gloeocapsa sp. PCC 7428
Genome accession: NC_019745
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2123087 - 2123773 bp
Length : 687 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ana:all1964 tw

DNA sequence : 
ATGCGAATTCTCTTAGTTGACGACGAAGTTGAACTTACCGATCCTTTAAGTCGCGTTCTTAGCCGCGAAGGTTATAGCGT
TGATGCTGCTTATGATGGTGCAACTGGTAGTGAACTAGCTTCCCACCAAGGCTACGACTTATTAATTTTAGACTGGATGC
TACCGTTTAAAACTGGCTTAGAAATCTGTCAGGAAGTACGACGCAACGGACAAACAACGCCTGTACTGTTTCTGACGGCT
AAAGATACCGTAGACGATCGCGTTCAAGGTTTAGACGCGGGTGCGGATGATTATCTCGTTAAACCGTTTGAATTACGCGA
GTTACTCGCACGAGTTCGCGCTTTGTTGCGGCGATCGGGTACTGAAGTGACAGCATCGACAACGCAAAAGTTACAAGTTG
CTGATTTAGAACTTGATTGTGAAAATCAGCTAGCGTATCGTCAAGAACGAATGATCGAATTATCAGAAAAAGAAAGTCAA
CTACTTGAATACTTTATGCGCAATACTGGGCATTTGCTAACGCATACACAAATTCAACAACATTTATGGGGCGATGGCGA
ACCGCCAAGTAGTAACGTGTTAGCTGCTTTAATTCGTTTACTACGTCGTAAAGTTGAAGCACCAGGAGAAACGCCACTGA
TTCACACTGTTTATGGCAAAGGTTATCGCTTTGGTGAAAATAGCTAA

Protein sequence : 
MRILLVDDEVELTDPLSRVLSREGYSVDAAYDGATGSELASHQGYDLLILDWMLPFKTGLEICQEVRRNGQTTPVLFLTA
KDTVDDRVQGLDAGADDYLVKPFELRELLARVRALLRRSGTEVTASTTQKLQVADLELDCENQLAYRQERMIELSEKESQ
LLEYFMRNTGHLLTHTQIQQHLWGDGEPPSSNVLAALIRLLRRKVEAPGETPLIHTVYGKGYRFGENS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-28 46
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0288 Protein 1e-31 44
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-32 43
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-26 43
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-27 43
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-24 43
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-28 42
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0487 Protein 8e-17 42
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family BAC0111 Protein 8e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-32 47
Glo7428_1879 YP_007127588.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-26 42