Gene Information

Name : Mic7113_3886 (Mic7113_3886)
Accession : YP_007123004.1
Strain : Microcoleus sp. PCC 7113
Genome accession: NC_019738
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4499065 - 4499667 bp
Length : 603 bp
Strand : -
Note : PFAM: Tellurium resistance protein; Bacterial stress protein

DNA sequence :
ATGGGAATTAACCTACAAAAAGGACAGCGCATCTCGCTTTCTAAAGAAGCACCTGGTCTTACAAAGCTCATGTGCGGACT
GGGTTGGGATGTAGCGAAAAGGTCAGGTGGTGGAATTTTTGGCGCTTTCAGCAATTCTCAAAACTATGACCTTGATTCAT
CAGTTATCTGTTTAGATGCCGACGGCAAAGTGAATAACAGAGCCAACGTGATTTCCTTTAGGAACTTAAGCCACCCATCA
GGAGCTATTACCCATTTGGGGGATAATCTCACGGGTGCAGGAGGAGGAGATGACGAGCAGATTCTTGTCGATTTAGCTCT
GGTGCCAAAAGAAATTGCAAAATTGGTATTCACTGTTAACATTTACGAATGCCTTGCCCGTAAACAAGACTTTGGGCAGG
TTCAAAATGCCTTTGTACGCCTGGTCAATATATCCAATAATAAAGAACTCGCCAGATATAACTTATCGGGTCAAGAATAC
AAAGGCATGACCGGGATGATCATGGCTGAAATATACAAGCACAATGATGAATGGAAAATGGCAGCCATTGGCAAGGGTGT
TAGCGTGAATGGTTTGGGAGAACTTGTGACTTCCTATGCTTAA

Protein sequence :
MGINLQKGQRISLSKEAPGLTKLMCGLGWDVAKRSGGGIFGAFSNSQNYDLDSSVICLDADGKVNNRANVISFRNLSHPS
GAITHLGDNLTGAGGGDDEQILVDLALVPKEIAKLVFTVNIYECLARKQDFGQVQNAFVRLVNISNNKELARYNLSGQEY
KGMTGMIMAEIYKHNDEWKMAAIGKGVSVNGLGELVTSYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-38 47
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-35 47
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-36 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-36 45
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-36 45
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 42
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-36 41
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-36 41
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mic7113_3886 YP_007123004.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 5e-35 42
Mic7113_3886 YP_007123004.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 2e-35 41