Gene Information

Name : Osc7112_2406 (Osc7112_2406)
Accession : YP_007115264.1
Strain : Oscillatoria nigro-viridis PCC 7112
Genome accession: NC_019729
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2812881 - 2813561 bp
Length : 681 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: syf:Synpcc7942

DNA sequence :
ATGAGCGATCGCATTCTCCTTGTTGAAGATGACCCTAAACTGGCAAAGTTCATCGAATCGGAACTTAGTCTTGAAGGATA
TCACGTTACTGTCGCCCCAAATGGATTGGATGGATTAACGATCGCTCGTGATGCTCAACCGGATTTATTAATTTTAGATT
GGATGCTTCCCGGCATCTCTGGATTAGACATCTGTTTAAGGTTGCGATCGACTGGTATTCAAGTACCAATAATTATGTTG
ACAGCAAAAGATGAAGTACCCGATCGCGTGACGGGATTAAATGCTGGAGCCGATGATTATGTTACTAAGCCTTTCAGTAT
GGAAGAACTCCTCGCGAGAGTCAAAGCCCGTCTGCGCCGCACTCAAGCCAATGACCCGGATAATTTACAATTTGAAGACC
TAATATTGAACGGTTTAACCCGTGAAGTTTATCGAGGCAGTCAACTAATTGAACTCACTGCAAAAGAGTTTGATTTGTTA
GAATTTATGCTGCAAAATTCCCGTCAAGTCATTACCCGCGAGCGAATTTTTGAAAAAGTTTGGGGTTACGATTTTATGGG
AGAGTCAAACATTATTGAAGTGTATATTCGTGCATTACGAATTAAGTTAGAAGCAAGTAACTCAAAACGCCTGCTGCATA
CGGTTCGGGGAGTTGGATACGTGTTGCGAGAGCAAAAGTGA

Protein sequence :
MSDRILLVEDDPKLAKFIESELSLEGYHVTVAPNGLDGLTIARDAQPDLLILDWMLPGISGLDICLRLRSTGIQVPIIML
TAKDEVPDRVTGLNAGADDYVTKPFSMEELLARVKARLRRTQANDPDNLQFEDLILNGLTREVYRGSQLIELTAKEFDLL
EFMLQNSRQVITRERIFEKVWGYDFMGESNIIEVYIRALRIKLEASNSKRLLHTVRGVGYVLREQK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-39 46
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-42 45
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 7e-44 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-44 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-43 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family BAC0083 Protein 5e-41 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family BAC0308 Protein 2e-40 44
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 8e-37 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-44 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-40 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-37 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-38 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family BAC0197 Protein 6e-38 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-34 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-37 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 9e-43 41
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-54 51
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-35 43
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family VFG1386 Protein 1e-46 42
Osc7112_2406 YP_007115264.1 two component transcriptional regulator, winged helix family VFG1389 Protein 5e-40 42