Gene Information

Name : GEI7407_2406 (GEI7407_2406)
Accession : YP_007109933.1
Strain : Geitlerinema sp. PCC 7407
Genome accession: NC_019703
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2950373 - 2951104 bp
Length : 732 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cyc:PCC7424_42

DNA sequence :
TTGGAAAATCATAAAGAAAAGATCTTGGTGGTGGATGACGAAGCTAGCATCCGCCGCATCCTAGAGACTCGTCTATCAAT
GATTGGCTACGACGTCGTTACGGCCGCTGACGGAGAAGAGGCTCTGGAAACCTTCCGGAACACTGCCCCTGACTTGGTTG
TGCTGGATGTCATGATGCCCAAGCTAGACGGCTACGGCGTCTGTCAAGAGCTGCGCAAAGAGTCTGACATCCCCATCATC
ATGCTAACGGCCCTGGGAGATGTCGCCGACCGGATTACGGGTTTGGAGCTCGGAGCCGACGATTATGTCGTCAAGCCCTT
CTCCCCAAAGGAGCTCGAGGCCCGCATTCGCTCTGTGCTGCGCCGCGTTGAGAAAACGGGGACTTCAGGCATTCCCAGCT
CTGGCGTCATCCATGTCAGCAGTCTGCGCATCGACACCAACAAGCGCCAAGTCTACAAAGGCGATGAGCGAATTCGGCTG
ACCGGTATGGAATTTAGCCTGCTGGAGCTGCTCGTTAGCCGCTCTGGTGAACCCTTCTCGCGCTCTGAAATTCTGCAAGA
GGTTTGGGGCTACACGCCTGAGCGCCATGTGGACACTCGCGTGGTAGACGTCCACATCTCGCGTTTGCGGGCCAAGCTGG
AGGATGACCCCAGCAATCCGGAGCTGATTTTGACGGCTCGAGGTACGGGCTACCTGTTCCAGCGGATTGTGGAGCCCGGC
ATGGAGGAGTAG

Protein sequence :
MENHKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRNTAPDLVVLDVMMPKLDGYGVCQELRKESDIPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVEKTGTSGIPSSGVIHVSSLRIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRIVEPG
MEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-47 50
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-47 50
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-46 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-46 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-46 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-46 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-46 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-46 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-46 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-47 49
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-39 46
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-43 46
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 46
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-43 45
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-36 43
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 9e-26 43
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-29 43
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 2e-38 43
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-36 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-38 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-31 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-34 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-28 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 5e-29 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator BAC0533 Protein 1e-29 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-34 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-28 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 1e-29 41
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-39 45
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-30 43
GEI7407_2406 YP_007109933.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-33 43