Gene Information

Name : Cha6605_5201 (Cha6605_5201)
Accession : YP_007099619.1
Strain : Chamaesiphon minutus PCC 6605
Genome accession: NC_019697
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5488719 - 5489300 bp
Length : 582 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence : 
ATGGCAGTCTCATTAGCCAAAGGGCAGCGTGTATCTCTAGAGAAAATCGCTCCAGGATTGACCGAAATTTTCGTTGGGTT
GGGTTGGGATGTCAAAGCGGTAGATACAGGGGTAGATTTCGATCTCGATGCTTCTGTGTTCTTACTCGGCAGTAACGAGA
AATTGATTTCTGACAAACATTTCATTTTTTATAATAATCTCACCAGTCCAGATGCCTCAAAATCTGTCGAACATACTGGC
GATAATCTCACTGGTGCAGGCGATGGCGATGATGAGATGGTTAAGATTAACTTCAAACAAGTTCCGGCGGAAGTAGATAA
GATTGTCGTTGCAGTGACAATTCACGAAGCTCAAGAACGCAAGCAAAATTTCGGTCAAGTTCAAAACGCGTTTGTTCGCA
TCGTCGATCTCCGAACTGAAAAAGAAGTCGTGCGTTATGACTTGGTAGAAGACTACTCCACCGAGACAGCTCTGATTATG
GCCGAACTCTATCGCAAAGATGGTGAATGGCGACTCAATGCCGTTGGGGCTGGTTATCAAGGCGGTTTGCAAGCATTACT
CGATCGGTATCAACCAAATTAG

Protein sequence : 
MAVSLAKGQRVSLEKIAPGLTEIFVGLGWDVKAVDTGVDFDLDASVFLLGSNEKLISDKHFIFYNNLTSPDASKSVEHTG
DNLTGAGDGDDEMVKINFKQVPAEVDKIVVAVTIHEAQERKQNFGQVQNAFVRIVDLRTEKEVVRYDLVEDYSTETALIM
AELYRKDGEWRLNAVGAGYQGGLQALLDRYQPN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-47 61
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-47 61
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-47 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-46 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-42 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-40 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-40 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-40 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cha6605_5201 YP_007099619.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 8e-45 60
Cha6605_5201 YP_007099619.1 putative stress response protein, TerZ- and CABP1 BAC0389 Protein 3e-46 59