Gene Information

Name : Cha6605_1569 (Cha6605_1569)
Accession : YP_007096250.1
Strain : Chamaesiphon minutus PCC 6605
Genome accession: NC_019697
Putative virulence/resistance : Resistance
Product : acetyltransferase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1646109 - 1646579 bp
Length : 471 bp
Strand : +
Note : PFAM: Acetyltransferase (GNAT) family

DNA sequence :
ATGAACTCAACCATTCAACAGCTTATGCCAGCGGACATTGCATTAATGTCGGCTCTTTTGACAACCTTTGGTGAGGCGTT
CGATGAGGTGGAAACCTATAGCGGTCGTCGTCCTAGCGAGGACTACCTGCGTCAACTGCTCAAAAGCGACTACTTTATTG
CGATCGCGGCATTGAAAGCAGGTGAGGTCGTTGGTGGACTCACAGCCTACGAGCTGAAAAAGTTCGAGCAGGAGCGCAGT
GAGATTTACATCTACGATTTGGCAGTTGCCGCAGCACACCGACGGGAGGGCATTGCAACGGCATTAATTCAGAAGCTGAA
GGAAGTAGCAGCAGAACGTGGAGCTTATGTTATTTTCGTCCAGGCAGATCTCGATGACGATCCAGCCATCGAACTTTATA
CCAAGCTGGGAATTCGCGAAGACGTGTTGCACTTTGACATTGCAGTCAATCGTGGTAATCACATTGCATAA

Protein sequence :
MNSTIQQLMPADIALMSALLTTFGEAFDEVETYSGRRPSEDYLRQLLKSDYFIAIAALKAGEVVGGLTAYELKKFEQERS
EIYIYDLAVAAAHRREGIATALIQKLKEVAAERGAYVIFVQADLDDDPAIELYTKLGIREDVLHFDIAVNRGNHIA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aacCA1 AGK36643.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR26 Protein 1e-37 59
aacC1/aacCA1 ACN81021.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR5 Protein 2e-37 59
aacC1/aacCA1 ACV89836.1 type A aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR7 Protein 1e-37 59
aacC1 AFV53117.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 1e-37 59
aac3 CAJ77083.1 Aminoglycoside 3-acetyltransferase Not tested AbaR1 Protein 9e-38 59
aacC1/aacCA1 ACV89833.1 type A aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR7 Protein 9e-38 59
aacC1 AFV53118.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 9e-38 59
aacC1 YP_005797146.1 aminoglycoside N(3')-acetyltransferase I Not tested AbaR4e Protein 1e-37 59
aacC1/aacCA1 ACN81020.1 aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR5 Protein 1e-37 59
aacCA5 AGK06968.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 5e-42 58
aacCA5 AGK07014.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 5e-42 58
aacCA5 AGK07072.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 5e-42 58
aacCA5 AAR21853.1 aminoglycoside (3) acetyltransferase; AacCA5 or AAC(3)-Ie Not tested SGI1 Protein 5e-42 58
aacCA5 AGF35061.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 5e-42 58
aacCA5 AGK06931.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 5e-42 58
acc(3)Ic ACY75521.1 Aac(3) Ic Not tested Tn6060 Protein 1e-40 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cha6605_1569 YP_007096250.1 acetyltransferase AF318077.1.gene3.p01 Protein 6e-38 60
Cha6605_1569 YP_007096250.1 acetyltransferase NC_011586.7045205.p0 Protein 4e-38 59
Cha6605_1569 YP_007096250.1 acetyltransferase NC_010410.6002585.p0 Protein 4e-38 59
Cha6605_1569 YP_007096250.1 acetyltransferase U04610.gene.p01 Protein 8e-38 58