Gene Information

Name : Nos7524_1988 (Nos7524_1988)
Accession : YP_007075442.1
Strain : Nostoc sp. PCC 7524
Genome accession: NC_019684
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2438564 - 2439274 bp
Length : 711 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGATATTTTAATTGTTGAGGATGAAACAGAAATTGCTCAATTAATCCAACATTCTTTAGAAAAAGAAGGATTTTCCTG
TCGCATTAGCCGCGATGGTATTAATGCTTTACAAATGTTTCAAGAACAACCACCAGATTTAATCATCCTAGACTTGATGA
TTCCTGGGTTAGATGGTTTAGAAGTATGCGCGAGAATTCGGCAGAAACCAGGAACAAAAGACCCTTATATTCTCATGCTC
ACAGCTAAAGGGGAAGAAATAGATCGAGTGATAGGTTTATCTACTGGCGCTGATGATTACATGGTGAAACCCTTCAGCCC
TAGAGAGTTGGTAGCGAGAGTGCGGGCGCTGTTGCGGCGGAGTTTGCGGCAAGGGGGACAAACTCAGGTGAATCGTACCC
AACACTTTATAGTGAATGTAGATCAACGTACTGCTAGCCGCCAGATGAGTCCCCAAAATATAGAAACTTTAGACTTAACA
ACTCTAGAATTCAACTTATTAAGCACTTTTGTGAGCAATCCCGGTAGAGTTTGGAACCGTACCCAATTAATTGACAAACT
TTGGGGAGATAACTTTTTTGGTGATGAGCGTGTAGTAGATACCCATGTGGCTCGATTACGGAAAAAAATTGAGCCTGATC
CTGCTAATCCCACTTTTATTAAAACTGTGGTGGGGGTTGGTTATAAATTTGAAGACTCCTCTCTGATTTAA

Protein sequence :
MDILIVEDETEIAQLIQHSLEKEGFSCRISRDGINALQMFQEQPPDLIILDLMIPGLDGLEVCARIRQKPGTKDPYILML
TAKGEEIDRVIGLSTGADDYMVKPFSPRELVARVRALLRRSLRQGGQTQVNRTQHFIVNVDQRTASRQMSPQNIETLDLT
TLEFNLLSTFVSNPGRVWNRTQLIDKLWGDNFFGDERVVDTHVARLRKKIEPDPANPTFIKTVVGVGYKFEDSSLI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-27 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-35 44
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 4e-32 43
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010410.6002989.p0 Protein 4e-33 43
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010400.5986590.p0 Protein 2e-32 43
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_011595.7057856.p0 Protein 4e-33 43
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-34 43
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-36 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000034.1.gene2186. Protein 5e-31 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP001918.1.gene3444. Protein 4e-31 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP001138.1.gene2239. Protein 2e-30 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002695.1.916589.p Protein 6e-31 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0039 Protein 5e-31 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000647.1.gene2531. Protein 2e-31 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0596 Protein 2e-30 42
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 5e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 4e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 7e-36 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 2e-28 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 5e-27 41
Nos7524_1988 YP_007075442.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 1e-26 41