Gene Information

Name : Nos7524_1955 (Nos7524_1955)
Accession : YP_007075411.1
Strain : Nostoc sp. PCC 7524
Genome accession: NC_019684
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2393345 - 2394019 bp
Length : 675 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGACAGCACATATCCTTCTGGTTGAAGATGAAGTTAAATTAGCGCGATTTGTGGAATTAGAACTGAGTAGCGAAGGTTA
TCAAGTCAGCGTAGCCCATGATGGTATAACTGGTTTAACCCTAGCGCGGGAGTCATCGCTAGATTTAGCCATTCTAGATT
GGATGTTGCCAGGATTAACAGGTTTGGAACTTTGTCGCCGCTTGCGAGCTACAGGAAACAAAATGCCAGTGATATTGTTG
ACAGCCAAAGATGAAGTGAGCGATCGCGTGGCAGGATTAGATGCAGGAGCCGATGATTATGTAGTTAAGCCCTTCAGTAT
TGAAGAACTACTAGCCAGAATCCGCGCCCATCTGCGCCGTACTCAAGACACAGATGATGATTTATTGCAGTTTGAAGACT
TGAGTTTAAATCGTCGTACCCGTGAAGTGTTTCGCGGTAAACGTGCAATTGAGTTAACCGCAAAAGAGTTTGACTTATTA
GAATATCTGCTTTCACATCCCCGGCAAGTTTTTACGAGAGAGCAAATTTTAGAGAAAGTTTGGGGTTATGATTTCATGGG
CGATTCTAATATTATTGAAGTTTATGTTCGTTATTTACGGCTCAAATTGGAAGAAAATAACGAGAAACGCTTAGTTCATA
CAGTGCGTGGTGTAGGTTACGCACTGCGTGAATAA

Protein sequence :
MTAHILLVEDEVKLARFVELELSSEGYQVSVAHDGITGLTLARESSLDLAILDWMLPGLTGLELCRRLRATGNKMPVILL
TAKDEVSDRVAGLDAGADDYVVKPFSIEELLARIRAHLRRTQDTDDDLLQFEDLSLNRRTREVFRGKRAIELTAKEFDLL
EYLLSHPRQVFTREQILEKVWGYDFMGDSNIIEVYVRYLRLKLEENNEKRLVHTVRGVGYALRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-33 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 9e-41 49
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 8e-44 48
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 3e-37 46
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 2e-38 45
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 1e-35 44
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 1e-38 44
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 2e-36 44
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 4e-33 44
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 6e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 8e-37 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 6e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 8e-38 43
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 2e-30 42
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 5e-33 41
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002516.2.879194.p Protein 1e-25 41
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000034.1.gene3671. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 3e-51 52
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 5e-34 46
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 2e-36 44
Nos7524_1955 YP_007075411.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 3e-41 43