Gene Information

Name : Lepto7376_1314 (Lepto7376_1314)
Accession : YP_007070500.1
Strain : Leptolyngbya sp. PCC 7376
Genome accession: NC_019683
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1480650 - 1481330 bp
Length : 681 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: syp:SYNPCC7002

DNA sequence :
ATGCGCATTCTGTTAGTCGATGACGAAAAAGAACTACGGGAAGCCTTGAGCCAGATTTTAGTGCGGGAAGGCTACGCTAT
TGAAACAGCAGATAACGGTCAAGCAGGTCTACAACTCGCCCAAAGCCAAGATTACGATTTACTGATTTTGGACTGGATGC
TACCCGAATATTCAGGCATCACCATTTGCAAACAAATACGTATCGCTGGTAAAGCCACACCTGTTCTAATTTTGACCGCC
AAAGATACGATTGATGATCGTGTACAAGGTCTAGATGCAGGAGCCGATGATTATCTTGTTAAACCCTTTGAGCTGCGGGA
ATTATTAGCGAGGGTGCGGGCATTATTGCGGCGATCGCCAATTATCGAACCACCAGAACGTCTGAAAATTGCTGACTTAG
ACCTCGACAAAGAAAATCAAGTTGCCTACCGCAATGGCAAAATGATTCGTTTATCTGACCGCGAACTACAGCTGCTCACA
TATTTTATGGAAAATGCCGAGCAACTCCTCACCCACGAACAAATTTATCAGCATCTCTGGCAGGATGAAACGCCGCCCAG
TAGTAATGTCCTAGCCGCTCTGATTCGTTTACTCCGCCGCAAAGTTGAAACAAAAGGCGATCGCCCCCTAATCCATACCA
TCTACGGCAAAGGTTATTATTTTGGCTTACAGGATACCTAA

Protein sequence :
MRILLVDDEKELREALSQILVREGYAIETADNGQAGLQLAQSQDYDLLILDWMLPEYSGITICKQIRIAGKATPVLILTA
KDTIDDRVQGLDAGADDYLVKPFELRELLARVRALLRRSPIIEPPERLKIADLDLDKENQVAYRNGKMIRLSDRELQLLT
YFMENAEQLLTHEQIYQHLWQDETPPSSNVLAALIRLLRRKVETKGDRPLIHTIYGKGYYFGLQDT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-30 45
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator BAC0288 Protein 2e-32 43
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-25 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 9e-31 42
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator BAC0347 Protein 7e-30 41
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-29 41
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator BAC0308 Protein 8e-27 41
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-29 41
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-34 43
Lepto7376_1314 YP_007070500.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-27 41