Gene Information

Name : Lepto7376_1060 (Lepto7376_1060)
Accession : YP_007070265.1
Strain : Leptolyngbya sp. PCC 7376
Genome accession: NC_019683
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1183580 - 1184260 bp
Length : 681 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_0615 t

DNA sequence :
ATGACGGATCACAAACTTCTCCTCATCGAAGACGACGATAATTTAGCGCGTTTTCTGGAACTCGAACTTAGTAGCGAAGG
CTATGGTATCACCGTCGCAAAAGATGGTCTCAGTGGTTTGATGGCAGCACGGGAAAATACGCCGGATTTAATTTTGTTGG
ACTGGATGTTACCGGGCATGACAGGAGTAGAGGTTTGTCGTCGCTTGCGGGCAACTGGGGCAGAATTGCCTGTGATTATG
CTGACAGCCAAGGATGAAATTCAGGATCGGGTGCAGGGCCTCGATGCTGGGGCAGATGATTATGTGGTGAAGCCCTTTAG
TATCGAGGAGCTTTTGGCGCGAATTCGTGCCCATCTCCGTCGGAATCAATCAGATGAAAAAGAGGTTTTACGGTTTGAGG
ATCTCAGACTCAATCGCACTACTCGTGAAATCTATCGGGGCGATCGCCTGATTGAGTTAACCGTTAAAGAATACGATTTG
CTGGAATATTTGCTGTCCCATGCGAAGCAAGTTTTAACTCGTAACCAAATTTTGGAACGGGTTTGGGGCTACGACGAAAC
AATGGGTGATTCCAATGTGATTGAAGTATATGTGCGTTATTTACGGTTGAAACTTGAAGCGGAAGGCGAATCTCGTCTGA
TTCATACTGTGCGAGGCGTTGGCTACGTTTTAAAAGACTAA

Protein sequence :
MTDHKLLLIEDDDNLARFLELELSSEGYGITVAKDGLSGLMAARENTPDLILLDWMLPGMTGVEVCRRLRATGAELPVIM
LTAKDEIQDRVQGLDAGADDYVVKPFSIEELLARIRAHLRRNQSDEKEVLRFEDLRLNRTTREIYRGDRLIELTVKEYDL
LEYLLSHAKQVLTRNQILERVWGYDETMGDSNVIEVYVRYLRLKLEAEGESRLIHTVRGVGYVLKD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-47 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-45 49
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-44 48
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-39 46
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-39 45
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-39 45
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-38 44
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-35 44
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-27 42
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-38 42
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-30 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-37 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-40 41
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-53 51
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-39 46
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-45 44
Lepto7376_1060 YP_007070265.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-31 43