Gene Information

Name : Cal7507_2541 (Cal7507_2541)
Accession : YP_007065802.1
Strain : Calothrix sp. PCC 7507
Genome accession: NC_019682
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2871272 - 2871847 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein; COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and putative cAMP-binding protein CABP1; InterPro IPR003325; KEGG: cyp:PCC8801_2078 stress protein; PFAM: Bacterial stress protein; SPTR: St

DNA sequence : 
ATGGCAGTTACACTTACAAAAGGACAACGCGTTTCACTAGAAAAAGTTGCACCAGGACTGACAGATATATTTATTGGTCT
TGGATGGGATGTTAAGCCAACAGACACCGGACACAACTTTGACTTAGATGCATCAGTTTTCTTACTAGGAAATAGCGAAA
AACTAATTTCTGATAACCACTTTATTTTTTACAATAATCTCTCTAGTCCAGACCCAGATAAGTCAGTTCAACACACTGGA
GATAACCTCACAGGTGCAGGTGATGGCGATGATGAAGTCATCAAGATTAATCTGCAAAAAGTTCCTGCTGACGTTCAAAA
AATTGTCATTACTGTAACTATTCATGAAGCCGCAGAACGAAGCCAAAATTTTGGTCAAGTTCAAAATGCTTTTGTGCGCG
TTGTTAATGCTCAGAGTAACCAAGAAGTAGTTCGCTATGACTTGGTTGAAGATTACTCAATTGAAACTGCATTAATTATG
GCTGAACTCTATCGTAAAGATGGAGAATGGCGTTTAAATGCCGTTGGTTCAGGCTATCAAGGTGGATTAAAAGCTTTGCT
AGATCGTTATCAGTAA

Protein sequence : 
MAVTLTKGQRVSLEKVAPGLTDIFIGLGWDVKPTDTGHNFDLDASVFLLGNSEKLISDNHFIFYNNLSSPDPDKSVQHTG
DNLTGAGDGDDEVIKINLQKVPADVQKIVITVTIHEAAERSQNFGQVQNAFVRVVNAQSNQEVVRYDLVEDYSIETALIM
AELYRKDGEWRLNAVGSGYQGGLKALLDRYQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-53 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-51 56
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-51 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-51 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-46 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-46 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-46 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-45 54
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-29 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cal7507_2541 YP_007065802.1 stress protein BAC0390 Protein 1e-50 60
Cal7507_2541 YP_007065802.1 stress protein BAC0389 Protein 5e-51 56